PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g51510.3.p
Common NameBRADI_3g51510, LOC100821218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 382aa    MW: 39258.4 Da    PI: 8.5888
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g51510.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-3974135263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       keka++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Bradi3g51510.3.p  74 KEKAINCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 135
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3270132IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3376132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90178132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDAAHWHQGL GLAKPMEEMM MPAGNQNPNA ANQNQNNQPP APPSGPEGVQ RAPAAAPAAA  60
AAAGGAERKA RPQKEKAINC PRCNSTNTKF CYYNNYSLQQ PRYFCKTCRR YWTEGGSLRN  120
VPVGGGSRKN KRSSSSSSAA AAAVSTSAAA GTVPAANKNP KLMLQHEAGG GAHDLNLAFP  180
HHHGRVLHPS EFAASFPSLE SSAVMAAANG GGRGGMHQGA FSAMELLRST GCYVPLPQGM  240
QLGAMPPEYG FALGPEFRMP APPHQQQQQH HQQQQQVQNM LGFSLDTGAG GGYGAGLQGA  300
QESAASGRML FPFEDLKPGV VSAAAGGATG GDQFEHSKAD QGQGQGGNNS GGHETLGFWN  360
NSMIGNGGSN DAGGGGGGGS W*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g51510.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824139e-84KC582413.1 Sorghum bicolor dof20 protein (dof20) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756972.10.0dof zinc finger protein 2 isoform X1
SwissprotB9F1L81e-102DOF2_ORYSJ; Dof zinc finger protein 2
TrEMBLA0A0Q3QG610.0A0A0Q3QG61_BRADI; Uncharacterized protein
STRINGBRADI3G51510.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.15e-39Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]