PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g50213.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Trihelix
Protein Properties Length: 1392aa    MW: 152255 Da    PI: 4.2208
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g50213.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.71.8e-2983167187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+++e+laLie+r+em++ +r++ lk+p Weevs+k+++rg++rs+k+Ckek+en+ k+yk+ ke + +r  ++ ++++yf qlea
  Bradi3g50213.1.p  83 RWPHDETLALIEIRSEMDSVFRNAGLKAPVWEEVSRKLAQRGYRRSAKKCKEKFENVDKYYKRSKEDRAGR--PDNKSYRYFAQLEA 167
                       8********************************************************************97..45557******985 PP

2trihelix68.71.2e-21378452186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k+ev aLi++r e++e  ++   k+ lW+++s++mr  g++rs+k+Ckekwen+nk++kk +           +tcpyf+qle
  Bradi3g50213.1.p 378 RWPKEEVDALIQLRMEKDELWQDLGGKALLWDDISAAMRNMGYHRSSKRCKEKWENINKYFKKDA-----------KTCPYFHQLE 452
                       8************************************************************9843...........3577777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.780142IPR001005SANT/Myb domain
CDDcd122031.07E-2782147No hitNo description
PROSITE profilePS500906.80682140IPR017877Myb-like domain
PfamPF138371.6E-2183168No hitNo description
SMARTSM007172.1E-4375437IPR001005SANT/Myb domain
CDDcd122032.04E-23377440No hitNo description
PROSITE profilePS500907.433378435IPR017877Myb-like domain
PfamPF138371.1E-14378453No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 1392 aa     Download sequence    Send to blast
MAGSVPSPQP PPVPAAVSLS LVPSPPSSVQ TPPSVTNSEV LPAAGTGAST GHGVINLNDI  60
NLVDGLRGRS TGEAGAGGSG CSRWPHDETL ALIEIRSEMD SVFRNAGLKA PVWEEVSRKL  120
AQRGYRRSAK KCKEKFENVD KYYKRSKEDR AGRPDNKSYR YFAQLEALHA ADPPQHQAAP  180
MAMAAAAARP LAMAHPGAGL LLPDHGFWSN TEPDSDNESD DEEEGGGGIS YKMLTVLVKR  240
LIKQVTKRQD AMQQLLLDKL ERWEAERTKR EQAWRAHELT RIKCEWEQLA QERATGATRD  300
AALIMLLQRI ITSGNSVSLP PSFSSLAAAN KQKAPVIQNT SQIHHHIEAL IASMQSVVAS  360
RSVGESSEGD NNGSGMPRWP KEEVDALIQL RMEKDELWQD LGGKALLWDD ISAAMRNMGY  420
HRSSKRCKEK WENINKYFKK DAKTCPYFHQ LEDIYRKRQQ FTMTGNGGSS STAPDDTTVT  480
VTFSEQPVLE QNHQCDLQGN IGNNFGMMVN DGGENSHASP CNDGHTAMHT TVVDDIAINE  540
EENTHRELED KINNDLGMVE NIEGGNLHTT LSNDGDTAMV TVVLDDSSIN KEENPHRELR  600
VRISNKFNMM GNDGGENLLA PSRNGGDTPM DNNMLDDDAK NKENPSRELE VKISKDFSMV  660
DNGGGENLHA PRSKDGATTV VTAVLDESAI NIEENLLAPP CNGGDMAIDT GVIDGSSTNK  720
ENRSRELESK ISNDFIAMDN VGGENLLSPP SNNDDTVVDT SVLDESAINK DKPSCAIEGK  780
INNDFAMRDN IGGENLIAPS NNGDTIVDTT LLHDSVVNKE ENPLYEHEVN INNHFSMMGN  840
GGVENLLAPP NNNGEMATDT VVLDDNAINK EENPSQELEG TISNDFAMII NGGGENLLSP  900
LRNDGDTTVD TTVLDGSIVN KEENPGHEHE VNISNHFGMM GSSGRENLLV PPSNNGEMAT  960
DTVVLDDNAI NKEENPLREL KGNISNDFAM MINGRGENLL SPPRNDDDTT VDTAVLDESA  1020
IKKEEDPWRN LEGNINNDFN MIGNDGEENL LAAPCNGVDT AMDATVLYDN AINHEKNPLR  1080
ELEDKTINEF AMMENSGEEK LLASSNNGGD TAMDTTMLDD STINKEENPR RELKGNVSND  1140
FDMMGSDEGE NLLAPPSNSD DIAMDTSVLD DIPINKENPL HELGGNINNE FVMMGNDGGE  1200
NLFAPPSHNC DTTMDTAVLD DSAINKEENP WRELEGNIRS DFSMMDNGGG ENLLAPPNNI  1260
GDKAMDTTVL DDSAINKENP WRELESKINN DFKMMDNGGW ENLLAPPSNN DDTTMDTGVL  1320
DDNPVNKKKE DIVMTTEANM QPQQKDFTDW EETCSDDIEG NYTHEDRDNG GGSSDNENDK  1380
MKCIVELRKQ Q*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g50213.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235774.20.0LOW QUALITY PROTEIN: uncharacterized protein LOC100830336
TrEMBLA0A2K2D4D90.0A0A2K2D4D9_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-41Trihelix family protein