PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g50160.2.p
Common NameBRADI_3g50160, LOC100835329
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 406aa    MW: 42619.1 Da    PI: 8.4204
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g50160.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.22.7e-19323357135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Bradi3g50160.2.p 323 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 357
                       *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.5E-18317371IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.965317353IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.32E-14320380No hitNo description
Gene3DG3DSA:3.30.50.101.8E-15321355IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.71E-14322379No hitNo description
PROSITE patternPS003440323348IPR000679Zinc finger, GATA-type
PfamPF003202.8E-17323357IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MTHQTLISSA PAFSSASHLL HASSPSPPTL FRRSSSAAAS VMSSFAHHHG SLVEKEGKMA  60
ALRSSLRPCE AAEDMAAAVA VGPAAWGAGL LGDGFLVEDL LDLEDLCEVD KEGGGVFPEA  120
APAADEEKSG DDHSHGSSVV SYELLPLLPP EMDMDLPAHD AEELEWVSRI MDDSLAELPP  180
QPQLPAAPSA AWQHRPRPRE AAASSAPADP MRTPTICALS TEASVPVKAK RSKRSRATVW  240
SLSGASLSDS ASSSTTTASS SGSSSTSLSS FLLDSPAFAA GSSLKKKSKH GKQHKPKKRG  300
RKPKHLASSP FLASVPVPGD RRCSHCGVQK TPQWRAGPEG AKTLCNACGV RYKSGRLLPE  360
YRPACSPTFV GTIHSNSHRK VLEMRRKKDP VVGFEAAAPT AVASF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569981.20.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0Q3QFK40.0A0A0Q3QFK4_BRADI; Uncharacterized protein
STRINGBRADI3G50160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-40GATA transcription factor 5