PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g46900.2.p
Common NameBRADI_3g46900, LOC100840938
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 345aa    MW: 37170.7 Da    PI: 6.65
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g46900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.2e-54161431129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL++k+++ +  +++++ e+d++k+ePwdLp++++ +ekewyfF+ +d+ky+tg+r+nrat+sgyWkatgkd+e+l
  Bradi3g46900.2.p  16 LPPGFRFHPTDEELVTHYLARKTADPTGFAARAVGEADLNKCEPWDLPSRATMGEKEWYFFVVKDRKYPTGTRTNRATESGYWKATGKDREIL 108
                       79**********************999666689***************988899*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       + +++lvg+kktLvfy+grapkg kt Wvmheyrle
  Bradi3g46900.2.p 109 R-GKALVGMKKTLVFYTGRAPKGGKTGWVMHEYRLE 143
                       9.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6312171IPR003441NAC domain
PROSITE profilePS5100559.94516171IPR003441NAC domain
PfamPF023653.9E-2917142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEHDVHQQQL EEPMELPPGF RFHPTDEELV THYLARKTAD PTGFAARAVG EADLNKCEPW  60
DLPSRATMGE KEWYFFVVKD RKYPTGTRTN RATESGYWKA TGKDREILRG KALVGMKKTL  120
VFYTGRAPKG GKTGWVMHEY RLEGKHAPAP YSLPRAATSK DEWVLCRVFK KSLEPSAAGS  180
NNGARKGACT GMAADAVGSS MSLADAGLAA LPPLIDVAAS GSFAPPPAAH VTCFSNALEG  240
QFLNPPFLLP ATTAAAAHSA GENIHIAMES AASPFFASMY TQDVSGGMAH EFLLDGGGGG  300
WYSKGERERL SGASQDTGLT SEVNPTEISS SRQHMDHEPT FWGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-551417215166NO APICAL MERISTEM PROTEIN
1ut4_B7e-551417215166NO APICAL MERISTEM PROTEIN
1ut7_A7e-551417215166NO APICAL MERISTEM PROTEIN
1ut7_B7e-551417215166NO APICAL MERISTEM PROTEIN
4dul_A7e-551417215166NAC domain-containing protein 19
4dul_B7e-551417215166NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g46900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952991e-172FP095299.1 Phyllostachys edulis cDNA clone: bphylf045c18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235594.10.0NAC domain-containing protein 92 isoform X2
TrEMBLI1IAW80.0I1IAW8_BRADI; Uncharacterized protein
STRINGBRADI3G46900.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-85NAC domain containing protein 100