PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g46320.2.p
Common NameBRADI_3g46320, LOC100827090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 362aa    MW: 40130.3 Da    PI: 7.1313
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g46320.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox567e-18182236256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Le+ F+++++++ e++  LA++l+L  rqV vWFqNrRa+ k
  Bradi3g46320.2.p 182 RKKLRLSKEQSASLEDSFKEHSTLTLEQKSNLANRLSLRPRQVEVWFQNRRARTK 236
                       678899***********************************************98 PP

2HD-ZIP_I/II119.41.9e-38182269188
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                       +kk+rlskeq+++LE+sF+e+++L+ e+K++la++L l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++ev+eLr
  Bradi3g46320.2.p 182 RKKLRLSKEQSASLEDSFKEHSTLTLEQKSNLANRLSLRPRQVEVWFQNRRARTKMKQTEVDCEYLKRCCETLTRENRRLQREVAELR 269
                       69************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-17167239IPR009057Homeodomain-like
SuperFamilySSF466893.21E-17173239IPR009057Homeodomain-like
PROSITE profilePS5007117.313178238IPR001356Homeobox domain
SMARTSM003891.1E-12180242IPR001356Homeobox domain
CDDcd000862.76E-15182236No hitNo description
PfamPF000463.9E-15182236IPR001356Homeobox domain
PROSITE patternPS000270213236IPR017970Homeobox, conserved site
SMARTSM003407.8E-21238283IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-10238269IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MICLWLLYIW YIYLLPLCPH HSKTPPPLIG MELELSLGDS PAPVNATITP AQAPTRTGKV  60
EDHKLVLGLR VTANERVEED NQRTSTPRAE TVYGEDDEAC HQTASPMEAS LSCLLPLVCA  120
QTGSADSEVC RRGLDVNTVP VDDGASTPQS LLPSSMEVEV AVRQAVDQEA SEDEDNGGGR  180
VRKKLRLSKE QSASLEDSFK EHSTLTLEQK SNLANRLSLR PRQVEVWFQN RRARTKMKQT  240
EVDCEYLKRC CETLTRENRR LQREVAELRT FRPTPTYPFY HHHHHLSGVS TALPACHSCD  300
NNNKATIYYA PPVVATPASI TTVSSPGQRS PPSSTASSLF ARPHFAPFTI HPVLRRQPSA  360
S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185RVRKKLR
2230238RRARTKMKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g46320.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755648.10.0homeobox-leucine zipper protein HOX7
RefseqXP_024318098.10.0homeobox-leucine zipper protein HOX7
SwissprotQ0E0A61e-107HOX7_ORYSJ; Homeobox-leucine zipper protein HOX7
TrEMBLA0A0Q3I2750.0A0A0Q3I275_BRADI; Uncharacterized protein
STRINGBRADI3G46320.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-51homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]