PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g38980.1.p
Common NameBRADI_3g38980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 258aa    MW: 26376.2 Da    PI: 5.866
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g38980.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.22.8e-3655113462
            zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +  +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lr vPvGgg+rk+ +ss
  Bradi3g38980.1.p  55 EGEACPRCESRDTKFCYYNNYNTSQPRHFCKGCRRYWTKGGTLRCVPVGGGTRKRASSS 113
                       5679**************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2355108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.65257111IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3057110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGEHAAAEPG RRPAQQQFAG VDLRRPKGYA AAAAAPAKTP AAAPVAATAA AAAAEGEACP  60
RCESRDTKFC YYNNYNTSQP RHFCKGCRRY WTKGGTLRCV PVGGGTRKRA SSSNTSAAAA  120
TVKRQKPSKK RRVAPPEPPA AASSADDVPA PDADAAAKTT TTPPTEAASE ITTELVVPAA  180
AAAEEDSFTD LLQEQGGGDD AVALDLGFSD YASAVGKAAG LGDPYSFEWP PAFDLGACWS  240
GAGFADPDPT GVFLNLP*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g38980.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0966123e-70FP096612.1 Phyllostachys edulis cDNA clone: bphyem122f05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755598.20.0dof zinc finger protein MNB1A, partial
SwissprotP385642e-69MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLI1I8470.0I1I847_BRADI; Uncharacterized protein
STRINGBRADI3G38980.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-27DOF zinc finger protein 1
Publications ? help Back to Top
  1. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]