PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g37810.1.p
Common NameBRADI_3g37810, LOC100826574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 347aa    MW: 36386.5 Da    PI: 6.7845
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g37810.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-18173227256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Bradi3g37810.1.p 173 RKKLRLSKDQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 227
                       778899***********************************************98 PP

2HD-ZIP_I/II128.33.2e-41173263192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlsk+q+++LEesF+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Bradi3g37810.1.p 173 RKKLRLSKDQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELSELR-ALK 263
                       69*************************************************************************************9.665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-18157227IPR009057Homeodomain-like
SuperFamilySSF466894.28E-18160230IPR009057Homeodomain-like
PROSITE profilePS5007117.038169229IPR001356Homeobox domain
SMARTSM003896.6E-16171233IPR001356Homeobox domain
CDDcd000861.90E-16173230No hitNo description
PfamPF000461.6E-15173227IPR001356Homeobox domain
PROSITE patternPS000270204227IPR017970Homeobox, conserved site
PfamPF021831.2E-10229263IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-25229272IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MELGLSLGEA PAVADAGRPA PELVLGLGVG AGRGGDQEGD KRRREAAAGA GWWAAATAAS  60
PEPSVRLSLV SSHGLRWPSD TGRSEATARG FDVNRMPSVA VGTELEEEED DPAAAAALSS  120
SPNDDSGGSF PFDLSAHGGH LGTSEAAAEA ALAGGGERSS SRASDDDEGA SARKKLRLSK  180
DQSAFLEESF KEHSTLNPKQ KVALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR  240
CCETLTEENR RLHKELSELR ALKTAQPFYM HLPATTLSMC PSCERVASNP AAAASSSASK  300
VISKAAAAPE QRTSSAFAAL FASPRGGFPL AAQTRPPPPP AASNCL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221229RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g37810.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574599.10.0homeobox-leucine zipper protein HOX27
SwissprotA2YW031e-141HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLI1I7P90.0I1I7P9_BRADI; Uncharacterized protein
STRINGBRADI3G37810.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-69homeobox from Arabidopsis thaliana