PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g36710.5.p
Common NameBRADI_3g36710, LOC100838007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 280aa    MW: 30742.7 Da    PI: 5.8835
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g36710.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.4e-301871255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      +rlrWt  LHerFv av++LGG+++AtPk++l++m+v+gLtl+h+kSHLQkYRl
  Bradi3g36710.5.p 18 ARLRWTRPLHERFVLAVSELGGADRATPKSVLRAMGVQGLTLYHLKSHLQKYRL 71
                      7****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-301575IPR009057Homeodomain-like
SuperFamilySSF466897.88E-151674IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-221872IPR006447Myb domain, plants
PfamPF002495.5E-61970IPR001005SANT/Myb domain
PfamPF143792.8E-15120159IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSSPSAQQHG GEAATARARL RWTRPLHERF VLAVSELGGA DRATPKSVLR AMGVQGLTLY  60
HLKSHLQKYR LAVSRDLAGN AGGGSLNVDR SSSSESQSNE YNDDDDTTAE LRDSSRSMAQ  120
MQREVQRKLH EQIEVQRTLQ LRMEAQGRYL QSVLRRAQQV LTDNSLAKAE LSELVSAVDT  180
ECLSSSSSQP RQQHRSAYSS CVSSSSSEAE SKSAGSRRRL HAGRHQGDCC TVEQPAQGKR  240
TFPFLQQMQD AEQQAAAEAE PEEEEEAEDG SSSEFDLNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-181772156Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-181675160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g36710.5.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952072e-59FP095207.1 Phyllostachys edulis cDNA clone: bphyem201h10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755397.10.0myb-related protein 2
TrEMBLI1I7C10.0I1I7C1_BRADI; Uncharacterized protein
STRINGBRADI3G36710.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-41G2-like family protein