PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g36260.2.p
Common NameBRADI_3g36260, LOC100829715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 414aa    MW: 43059.9 Da    PI: 7.6977
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g36260.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32212265255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Bradi3g36260.2.p 212 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 265
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15209266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28210266IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-24212265IPR006447Myb domain, plants
PfamPF002496.0E-7213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MEAAAPSPDL SLHISLPTSG TMMPTSAPGL GAAAAAGGAG GDPWRRLNGS TASTELSLSP  60
PPPPPPQGHQ QADVLPWRLR QMMASSSVPV TLPTRPLDAA AAAESSARPI RGIPVYSRPG  120
AAHHPFYNNP YYCQSSEAWP PSSTAPSSSV DAAAAASAAA FLSPSAYHRM LSSTGRLHGV  180
LADTLRGYGA LGAASRFMLP KLPGSRRSMR APRMRWTSSL HARFVHAVEL LGGHERATPK  240
SVLELMDVKD LTLAHVKSHL QMYRTVKSTD KPASSSGPMD GIGSGSGDDN LPDSVRQATS  300
GGDMNPQLFN EHNRSSSECT ASPAAAGAGD VDCSSSAANS DSRARSDSRD LWPSSNGCDP  360
AAHRLVGASR AVEGIEPACR SSSLQLQVSS HELSCPSLEF TLGRPNWHGA DHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-17213267357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-17213267357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-17213267357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-17213267357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g36260.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865283e-74DQ286528.1 Zea mays KANADI1-like protein (kan1b) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572210.10.0probable transcription factor RL9
SwissprotQ0J2354e-95ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0Q3ID310.0A0A0Q3ID31_BRADI; Uncharacterized protein
STRINGBRADI3G36260.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-49G2-like family protein