PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g33957.2.p
Common NameBRADI_3g33957, LOC100843368
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 351aa    MW: 37767.7 Da    PI: 5.4598
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g33957.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-5261341128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtd+elv +yLk++v++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd++
  Bradi3g33957.2.p   6 LPPGFRFHPTDDELVGYYLKRRVDNLKIEL-EVIPVIDLYKFEPWELPeKsFLPKKDLEWFFFVPRDRKYPNGSRTNRATTTGYWKATGKDRK 97 
                       79****************************.99**************95334445666*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v + +g++ g++ktLvfy+grap ge+tdWvmheyrl
  Bradi3g33957.2.p  98 VSCDGGAVCGVRKTLVFYRGRAPGGERTDWVMHEYRL 134
                       ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-593157IPR003441NAC domain
PROSITE profilePS5100557.2086158IPR003441NAC domain
PfamPF023653.0E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRRVDN LKIELEVIPV IDLYKFEPWE LPEKSFLPKK  60
DLEWFFFVPR DRKYPNGSRT NRATTTGYWK ATGKDRKVSC DGGAVCGVRK TLVFYRGRAP  120
GGERTDWVMH EYRLCQDLSL HGASVFLGAY ALCRVVKRSE AGLINGDAAA KAMVPAVAGK  180
GARMSKVASS SSLVTADHQQ PSNGSSPFTP SPTRLDIIGG GGGTESWRDM APAPLCFPPQ  240
QEDAAFFVGG TGDLLFPSAA GECDPFIFGD IGGGGGALIP ENELRWDNFP STNNGFPATG  300
GFMPSSGAGE LWNPAPPNAG GAPLLCRQAS DGIDDLTAWF SPVDENMVVF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-51116212169NO APICAL MERISTEM PROTEIN
1ut4_B3e-51116212169NO APICAL MERISTEM PROTEIN
1ut7_A3e-51116212169NO APICAL MERISTEM PROTEIN
1ut7_B3e-51116212169NO APICAL MERISTEM PROTEIN
3swm_A3e-51116215172NAC domain-containing protein 19
3swm_B3e-51116215172NAC domain-containing protein 19
3swm_C3e-51116215172NAC domain-containing protein 19
3swm_D3e-51116215172NAC domain-containing protein 19
3swp_A3e-51116215172NAC domain-containing protein 19
3swp_B3e-51116215172NAC domain-containing protein 19
3swp_C3e-51116215172NAC domain-containing protein 19
3swp_D3e-51116215172NAC domain-containing protein 19
4dul_A3e-51116212169NAC domain-containing protein 19
4dul_B3e-51116212169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g33957.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689851e-120AK368985.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2083F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235019.20.0NAC domain-containing protein 72
TrEMBLA0A0Q3FE610.0A0A0Q3FE61_BRADI; Uncharacterized protein
STRINGBRADI3G33957.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.15e-81NAC domain containing protein 71