PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g33410.1.p
Common NameBRADI_3g33410, LOC100830219
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 273aa    MW: 29061.8 Da    PI: 10.2407
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g33410.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-19124178256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Bradi3g33410.1.p 124 RKKLRLSKDQSAVLEDSFNQHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTK 178
                       788899***********************************************98 PP

2HD-ZIP_I/II127.84.7e-41124211188
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                       +kk+rlsk+q+++LE+sF+++++L+p++K++lar+Lgl+prqv+vWFqnrRARtk+kq+E+d+eaL+r++dal+een+rL +ev++L+
  Bradi3g33410.1.p 124 RKKLRLSKDQSAVLEDSFNQHSTLNPKQKAALARQLGLRPRQVEVWFQNRRARTKLKQTEVDCEALRRRCDALTEENRRLLREVQALK 211
                       69************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.0E-171096IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.9E-19110174IPR009057Homeodomain-like
PROSITE profilePS5007117.038120180IPR001356Homeobox domain
SMARTSM003891.7E-17122184IPR001356Homeobox domain
SuperFamilySSF466896.68E-19123189IPR009057Homeodomain-like
CDDcd000863.42E-17124181No hitNo description
PfamPF000461.5E-16124178IPR001356Homeobox domain
PRINTSPR000315.8E-6151160IPR000047Helix-turn-helix motif
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PRINTSPR000315.8E-6160176IPR000047Helix-turn-helix motif
SMARTSM003402.1E-13180223IPR003106Leucine zipper, homeobox-associated
PfamPF021833.1E-10180211IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEMTVVNGRD HLGLGLGLSL GIAGTTSSVA APQRALTGAA PTPGQKTRTA SACHEMPLFL  60
RGIDVNRAPD AGHEEEEPGA SSPDSTLSTL SGKRGRSAAG AGGREQERVS DDDEDSGSGA  120
GGSRKKLRLS KDQSAVLEDS FNQHSTLNPK QKAALARQLG LRPRQVEVWF QNRRARTKLK  180
QTEVDCEALR RRCDALTEEN RRLLREVQAL KLPLPHPQLY MRAPPLTMCP SCERVAPSGK  240
PAVAGNSTAL GSGPWGPGPV RPVFVDRPAQ RA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128SRKKLRL
2172180RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:10934011, ECO:0000269|PubMed:9076993}.
UniProtProbable transcription repressor involved leaf development. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. May act as a regulatory switch to specify provascular cell fate. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:9076993}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g33410.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10732669}.
UniProtINDUCTION: By auxin and sucrose in primary root apical region. By wounding in leaves. {ECO:0000269|PubMed:10934011}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3669661e-131AK366966.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2049C06.
GenBankAK3685491e-131AK368549.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075M23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572077.10.0homeobox-leucine zipper protein HOX1
SwissprotQ406912e-68HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC542e-68HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLA0A0Q3JI530.0A0A0Q3JI53_BRADI; Uncharacterized protein
STRINGBRADI3G33410.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.13e-56homeobox-leucine zipper protein 4
Publications ? help Back to Top
  1. Scarpella E,Boot KJ,Rueb S,Meijer AH
    The procambium specification gene Oshox1 promotes polar auxin transport capacity and reduces its sensitivity toward inhibition.
    Plant Physiol., 2002. 130(3): p. 1349-60
    [PMID:12428000]
  2. Scarpella E,Rueb S,Meijer AH
    The RADICLELESS1 gene is required for vascular pattern formation in rice.
    Development, 2003. 130(4): p. 645-58
    [PMID:12505996]
  3. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  4. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  5. Scarpella E,Simons EJ,Meijer AH
    Multiple regulatory elements contribute to the vascular-specific expression of the rice HD-Zip gene Oshox1 in Arabidopsis.
    Plant Cell Physiol., 2005. 46(8): p. 1400-10
    [PMID:15964905]
  6. Meijer AH,Ouwerkerk PB,Hoge JH
    Vectors for transcription factor cloning and target site identification by means of genetic selection in yeast.
    Yeast, 1998. 14(15): p. 1407-15
    [PMID:9848232]