PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g33200.1.p
Common NameBRADI_3g33200, LOC100844292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 362aa    MW: 37558.8 Da    PI: 8.1076
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g33200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.67.1e-18262296135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  Bradi3g33200.1.p 262 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 296
                       *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.6E-16256306IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.227260292IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.8E-13260294IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.09E-13260320No hitNo description
CDDcd002024.01E-14261308No hitNo description
PROSITE patternPS003440262287IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15262296IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MASEWEIAMG VELGMGMGAY NTTSSAGAAA PMGHHAGGGY HFYGMQPMGA ADPSMRVDEL  60
LDLSSAGAGA HDFFPAAAAD NGHYHYHHLG PGVGEPSAAT TPSATSSDHQ TSMLSFADEF  120
YIPSEEAAEL EWLSKFVDDS YSDMPNYSSA AHAAMAKAAA AASNSPAGQH GSCITAAAPP  180
GRGARSKRSR ASAAAAAAWH SLMPRPPSQS SPSSSSCSSS DIPASSNKPA RPNNSNGSRG  240
KKQGPPVADQ SVGLVEGGVR RCTHCASEKT PQWRTGPLGP KTLCNACGVR FKSGRLVPEY  300
RPAASPTFLL TQHSNSHRKV MELRRQKEIV LIRGSHPSVP TGPAGAATVK PELLFRDYGI  360
C*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g33200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574323.10.0GATA transcription factor 2
TrEMBLI1I6370.0I1I637_BRADI; GATA transcription factor
STRINGBRADI3G33200.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.13e-46GATA transcription factor 2