PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g32241.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 334aa    MW: 36634.3 Da    PI: 8.4436
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g32241.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.8e-322881255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtpeLH+rFv+a+++LGG+++AtPk++l+lm+v gLt++hvkSHLQ+YR 
  Bradi3g32241.1.p 28 PRLRWTPELHRRFVHAIHSLGGHHRATPKRVLQLMGVGGLTISHVKSHLQMYRN 81
                      8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5782484IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-302482IPR009057Homeodomain-like
SuperFamilySSF466893.94E-162681IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-232881IPR006447Myb domain, plants
PfamPF002494.3E-102980IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MTMESRTTMA AGRDRVDRVR QYNRSKVPRL RWTPELHRRF VHAIHSLGGH HRATPKRVLQ  60
LMGVGGLTIS HVKSHLQMYR NMRGNDLDMM QGIQRMDQEH TFSGGMEVWT DMQQVHHHHE  120
YCDGPYCSRH SPKHTVLLHH TQLKRPSQSQ MGSVQEAEAS RPQKRLLQGI SERDAAPGAG  180
GRLLLRQYSL AAAAAGYCFQ REPAAAGGGG EQADPPSCTL ACLVAPTRAN CDDPCEEQIS  240
GCEEPVQQEE GGRGYVAAPA SCYGEERGDG ELTLSLSLDL DSGRPLMRRS SEQGSCFLRP  300
SVRGGGGGCC SGRRRRGRGG CVCLDLSLSS LYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-182983357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-182983357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-182983357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-182983357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g32241.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572016.30.0uncharacterized protein LOC100832345
TrEMBLA0A2K2D0I10.0A0A2K2D0I1_BRADI; Uncharacterized protein
STRINGTraes_1BL_E2629CBC1.11e-88(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-26G2-like family protein