PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g30457.1.p
Common NameBRADI_3g30457, LOC100823187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Trihelix
Protein Properties Length: 770aa    MW: 82085 Da    PI: 5.9029
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g30457.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.89.4e-3188172187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+l+L+++r++m+ ++r++ lk+plWeevs+k++e+g++r++k+Ckek+en++k+yk++k+++ +r  ++ +t+++f+qlea
  Bradi3g30457.1.p  88 RWPRQETLVLLKIRSDMDAAFRDATLKGPLWEEVSRKLAEEGYRRNAKKCKEKFENVHKYYKRTKDSRAGR--NDGKTYRFFQQLEA 172
                       8********************************************************************97..56668*******85 PP

2trihelix109.61.9e-34455540187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+++++r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  Bradi3g30457.1.p 455 RWPKAEVHALIQLRSNLDTRYQEAGPKGPLWEEISAGMRRMGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 540
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.09885147IPR001005SANT/Myb domain
CDDcd122038.27E-2987152No hitNo description
PfamPF138374.8E-2187173No hitNo description
PROSITE profilePS500906.53987145IPR017877Myb-like domain
PROSITE profilePS500907.48448512IPR017877Myb-like domain
SMARTSM007170.0053452514IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-4453511IPR009057Homeodomain-like
PfamPF138373.2E-23454541No hitNo description
CDDcd122031.59E-29455519No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MQQQQGGGGG PGQQFGLHPP EMPPFSPAGQ RISMAEAPSP ISSRPPAPPG QQQLSSNELA  60
GAAAAMSFDE EALAAGEEGG GGGSGGNRWP RQETLVLLKI RSDMDAAFRD ATLKGPLWEE  120
VSRKLAEEGY RRNAKKCKEK FENVHKYYKR TKDSRAGRND GKTYRFFQQL EALQGATPGA  180
GASSVPPPAT AVRAPAEPPP QPVVAGAMPT PMGVGNLSFS TSNTEEFSED EDEEDDSDDE  240
GTDDMAVVGN KRKRMSSDGV AAAGGHNNKK MMRFFEGLMR QVMERQEAMQ QRFLEAIEKR  300
EQDRMIREEA WRRQEMARLA REQETLAQER AMAASRDAAV LGFIQKITGQ SVPMPMAPPP  360
PSIAFMPPPP AGSHPTPISF SAAPPSSSQS PATQASPRPQ KPPMPLPTPA PQKTPVPATP  420
PPQQQSGGME MVVSAPAGGE LQLHDGGSGS ASSSRWPKAE VHALIQLRSN LDTRYQEAGP  480
KGPLWEEISA GMRRMGYSRS SKRCKEKWEN INKYFKKVKE SNKKRPEDSK TCPYFHQLEA  540
LYRNKQQAAL TSPSAAAAPL PALAAPPPPE PFTVAAPISQ TPPTTTHALQ QPAAAKNGAG  600
NGHGNGNGSG VAACSEGGSV SAGGMQASNG FFGEAGVAAK KPEGMMKETI MEQRQQAQAA  660
PISSSYNNRA GVVDSDNSMD DEDDYDDEDE EDDDDDDVDG NKMQYEIQFQ SQQHHQLHQQ  720
HHQHNNHNVV RPNAGAAGGG NQPGAAAPPS AASAAAATTT AGSFLGMVQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g30457.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3544261e-120AK354426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1007E05.
GenBankAK3615071e-120AK361507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1142F04.
GenBankAK3727131e-120AK372713.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010E21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574172.10.0trihelix transcription factor GTL1 isoform X1
RefseqXP_010234894.10.0trihelix transcription factor GTL1 isoform X1
TrEMBLI1I5990.0I1I599_BRADI; Uncharacterized protein
STRINGBRADI3G30457.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.19e-52Trihelix family protein