PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g29940.1.p
Common NameBRADI_3g29940, LOC100825418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 257aa    MW: 26142.1 Da    PI: 9.3259
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g29940.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof99.91.7e-3175130560
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++cprC s ntkfCyynnys +qPry+C+aCrr+Wt+GG+lr+vPvGggr+ +++
  Bradi3g29940.1.p  75 PRDCPRCRSGNTKFCYYNNYSRKQPRYLCRACRRHWTEGGTLRDVPVGGGRKSRRN 130
                       578***********************************************876654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.6E-2976129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.7776130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-1983127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MASPFLAGSS SSSASSPLSY MIPSSSLALA AQGQGQGFLS CGVLAQQGPQ GDAVGVGAPR  60
QGGTGRHAGL PRPPPRDCPR CRSGNTKFCY YNNYSRKQPR YLCRACRRHW TEGGTLRDVP  120
VGGGRKSRRN NGAGSRKAAA TKASASPSTA DAAAAAGVDG SLVVPADVLR QMLFFQPAGF  180
EGGYGIDMGA WQQQQMAAAA PNATKAPQGV GGEVGAGVEG TSASAADGVN CGAGMQFWSG  240
GWQQMQDDMP GFDGTF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g29940.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843612e-71AM084361.1 Hordeum vulgare subsp. vulgare dof13 gene for dof zinc finger protein 13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571940.10.0dof zinc finger protein 1
TrEMBLI1I5320.0I1I532_BRADI; Uncharacterized protein
STRINGBRADI3G29940.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-20Dof family protein