PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g25670.1.p
Common NameBRADI_3g25670, LOC100841048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 437aa    MW: 46697.4 Da    PI: 8.1733
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g25670.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3987145260
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       ++k+l+cprC s++tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk+
  Bradi3g25670.1.p  87 PDKILPCPRCSSMDTKFCYFNNYNINQPRHFCKKCQRYWTAGGAMRNVPVGAGRRKNKN 145
                       7899*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3176144IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3189145IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.53791145IPR003851Zinc finger, Dof-type
PROSITE patternPS01361093129IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MAECRGGDGL IKLFGKTIPV PEPVGALSKD LGHSGSSSTE SGVQEITTDP SPQPEVVDAE  60
DPAVDKGSQL QSGDDEAASE KEKLKKPDKI LPCPRCSSMD TKFCYFNNYN INQPRHFCKK  120
CQRYWTAGGA MRNVPVGAGR RKNKNVLAAS NFLQRVRAAL PVDTFCSSPC PPVKTNGTVL  180
SFGHDASSTL DLAEHLKDNR IPIARSRNAR DNPSMGSCSE VVSSNRNDKD QRNDITVEKS  240
ANGVQQQHPA GMNGGTMWPY GCTPSPAAYY TSGIAIPIYP GAPGPGYWGC MVPGAWSLPW  300
PVQCQPQALS SPTSAPSVSS APSPLTLGKH PRDQADEGNR GHGNGNGKVW VPKTIRIDNA  360
DEVARSSIRS LFGIKGDDRD EQISGTSGHK LATSVFEPKQ HEAKMAKHAE AITSLPLLHH  420
ANPVALTRSV IFHEGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g25670.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0351622e-69BT035162.1 Zea mays full-length cDNA clone ZM_BFb0042O20 mRNA, complete cds.
GenBankBT0673162e-69BT067316.1 Zea mays full-length cDNA clone ZM_BFc0006N22 mRNA, complete cds.
GenBankEU9436272e-69EU943627.1 Zea mays clone 1638962 mRNA sequence.
GenBankEU9571712e-69EU957171.1 Zea mays clone 1584660 hypothetical protein mRNA, complete cds.
GenBankJX4284592e-69JX428459.1 Zea mays subsp. mays clone pUT3054 DOF40 C2C2-DOF type transcription factor mRNA, partial cds.
GenBankJX4284792e-69JX428479.1 Zea mays subsp. mays clone pUT3075 DOF21 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573898.10.0cyclic dof factor 1
TrEMBLI1I3V10.0I1I3V1_BRADI; Uncharacterized protein
STRINGBRADI3G25670.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.16e-52cycling DOF factor 3