PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g22297.1.p
Common NameBRADI_3g22297, LOC100831869
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 204aa    MW: 22643.8 Da    PI: 7.1272
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g22297.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.85.2e-333690155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWt +LH+rFv+a++qLGG++kAtPktil++m+vkgLtl h+kSHLQkYRl
  Bradi3g22297.1.p 36 KPRLRWTADLHDRFVDAIAQLGGPDKATPKTILRTMGVKGLTLFHLKSHLQKYRL 90
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-313391IPR009057Homeodomain-like
PROSITE profilePS5129411.0983393IPR017930Myb domain
SuperFamilySSF466891.11E-163692IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-253691IPR006447Myb domain, plants
PfamPF002497.6E-83889IPR001005SANT/Myb domain
PfamPF143794.8E-18131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MFPGLIHHHH QHAADDAPRG HGGGSAPSLV LTADPKPRLR WTADLHDRFV DAIAQLGGPD  60
KATPKTILRT MGVKGLTLFH LKSHLQKYRL GKQSGKEITE QSKDGSYLME AQSGINLSPR  120
IPIPDVEESQ EVKEALREQM EVQRRLHEQV KVQECVKIRR EAHQTYIDSL LEKACMLVSE  180
QLSGFSISDY DLPDLASAGF QIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-183692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-183692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-183692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-183692157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g22297.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573786.11e-149protein PHR1-LIKE 2
SwissprotQ94A576e-64PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLI1I3951e-148I1I395_BRADI; Uncharacterized protein
STRINGBRADI3G22297.11e-148(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34273873
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-66G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]