PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g22290.4.p
Common NameBRADI_3g22290, LOC100832165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 308aa    MW: 33948.7 Da    PI: 6.1834
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g22290.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.6e-3347101155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       ++rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Bradi3g22290.4.p  47 RQRLRWTNELHDRFVEAVTQLGGPDRATPKGVLKIMGVPGLTIYHVKSHLQKYRL 101
                       58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3644104IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-3246102IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1846101IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-2648102IPR006447Myb domain, plants
PfamPF002493.7E-949100IPR001005SANT/Myb domain
PfamPF143795.3E-24134180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MYQPNQISSI GHNHGSPAAH EQMELGGTSM SMVPCNGGND NPNMASRQRL RWTNELHDRF  60
VEAVTQLGGP DRATPKGVLK IMGVPGLTIY HVKSHLQKYR LAKYIPDPSA SDDNKAEERD  120
PGDLLAALEG SSGMPISEAL KLQMEVQKRL HEQLEVQRQL QLRIEAQGKY LQKIIEEQQR  180
ITAAGPSRAT SSDQMPDSER TNPSTPGLTS ESRVHGSTKN NKNQIELTKS SPNDDPLACR  240
QPLTPDCSRP SSPTLSPEHE RPVKRQRGSD PVDDTSFDDD QFVLPRTIFE SSTATEFQDC  300
SSPYSGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g22290.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573787.10.0myb family transcription factor PHL7
RefseqXP_024317461.10.0myb family transcription factor PHL7
SwissprotQ9SJW02e-79PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLI1I3940.0I1I394_BRADI; Uncharacterized protein
STRINGBRADI3G22290.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-66G2-like family protein