PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g21480.1.p
Common NameBRADI_3g21480, LOC100821511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 240aa    MW: 26294.7 Da    PI: 8.0267
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g21480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.8e-1897151256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq   Le+ F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Bradi3g21480.1.p  97 RKKLRLTKEQSALLEDRFKEHSTLNPKQKAVLARQLNLRPRQVEVWFQNRRARTK 151
                       78889************************************************98 PP

2HD-ZIP_I/II125.32.7e-4097185190
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                       +kk+rl+keq++lLE+ F+e+++L+p++K+ lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++e ++Lr +
  Bradi3g21480.1.p  97 RKKLRLTKEQSALLEDRFKEHSTLNPKQKAVLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEVLKRCCETLTEENRRLHRELNNLR-A 185
                       69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1986154IPR009057Homeodomain-like
PROSITE profilePS5007117.293153IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-1793152IPR009057Homeodomain-like
SMARTSM003892.5E-1595157IPR001356Homeobox domain
PfamPF000462.1E-1597151IPR001356Homeobox domain
CDDcd000861.73E-1597154No hitNo description
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
PfamPF021831.2E-10153185IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-18153196IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MLMAAQEEVA GLALDLSLGS AGGHHRLQQK EASAAPQQHC ALPSLTLSLQ AGAAVKREAA  60
EEEEEEDERA FLYYSAASSA ADDDVVDREA GCNGSSRKKL RLTKEQSALL EDRFKEHSTL  120
NPKQKAVLAR QLNLRPRQVE VWFQNRRART KLKQTEVDCE VLKRCCETLT EENRRLHREL  180
NNLRAIHHHH SAFFVPAAAT LSVCPSCDRL AATGAPPASV VADRPAAKRS FFATKSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195101SRKKLRL
2145153RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g21480.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0989841e-105FP098984.1 Phyllostachys edulis cDNA clone: bphylf047o12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571682.11e-174homeobox-leucine zipper protein HOX15
SwissprotQ7G7378e-68HOX15_ORYSJ; Homeobox-leucine zipper protein HOX15
TrEMBLI1I3341e-172I1I334_BRADI; Uncharacterized protein
STRINGBRADI3G21480.11e-173(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-48homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]