PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g17287.1.p
Common NameBRADI_3g17287, LOC100823590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 286aa    MW: 32189.7 Da    PI: 8.3595
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g17287.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83.1e-51111361128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       +ppGfrFhP+deelv +yL +k++g+      +i +vd++k+ePwdLp ++  + kewy +s rd+kyatg+r+nrat+sgyWkatgkd+++ 
  Bradi3g17287.1.p  11 MPPGFRFHPRDEELVLDYLLHKLTGHGGAG-VAIVDVDLNKCEPWDLPDAACVGGKEWYLYSLRDRKYATGHRTNRATQSGYWKATGKDRPIR 102
                       79************************9666.57***************7666789************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +  ++lvg++ktLvfy+grapkg++t+Wvmhe+rl
  Bradi3g17287.1.p 103 R-CRQLVGMRKTLVFYQGRAPKGTRTEWVMHEFRL 136
                       9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-603169IPR003441NAC domain
PROSITE profilePS5100554.84911169IPR003441NAC domain
PfamPF023652.3E-2412136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MSYIGMMEAR MPPGFRFHPR DEELVLDYLL HKLTGHGGAG VAIVDVDLNK CEPWDLPDAA  60
CVGGKEWYLY SLRDRKYATG HRTNRATQSG YWKATGKDRP IRRCRQLVGM RKTLVFYQGR  120
APKGTRTEWV MHEFRLIQQD HGDHPLPRPP ARSSSDLKED WVLCRVFYKS RTTTPRPPSE  180
EACTFSSELN LQAAPPLVPL VDTYIAFEGG TTMTAVEQVT CFSGLPVLPF KGSVSFGDLL  240
SWDDPEKKAI RTALSNMPSS NSNSKLELPP NWSQENALSQ MWTPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51617312169NO APICAL MERISTEM PROTEIN
1ut4_B2e-51617312169NO APICAL MERISTEM PROTEIN
1ut7_A2e-51617312169NO APICAL MERISTEM PROTEIN
1ut7_B2e-51617312169NO APICAL MERISTEM PROTEIN
3swm_A1e-51617315172NAC domain-containing protein 19
3swm_B1e-51617315172NAC domain-containing protein 19
3swm_C1e-51617315172NAC domain-containing protein 19
3swm_D1e-51617315172NAC domain-containing protein 19
3swp_A1e-51617315172NAC domain-containing protein 19
3swp_B1e-51617315172NAC domain-containing protein 19
3swp_C1e-51617315172NAC domain-containing protein 19
3swp_D1e-51617315172NAC domain-containing protein 19
4dul_A2e-51617312169NAC domain-containing protein 19
4dul_B2e-51617312169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g17287.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573507.10.0NAC domain-containing protein 21/22
SwissprotQ84TE62e-76NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0Q3JAX30.0A0A0Q3JAX3_BRADI; Uncharacterized protein
STRINGBRADI3G17287.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.27e-79NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]