PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g16340.1.p
Common NameBRADI_3g16340, LOC100821114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 330aa    MW: 35162.4 Da    PI: 7.3332
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g16340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-32145198255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Bradi3g16340.1.p 145 PRMRWTSTLHSRFVHAVELLGGHDRATPKAVLELMDVKDLTLAHVKSHLQMYRT 198
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-29142199IPR009057Homeodomain-like
SuperFamilySSF466891.02E-15143199IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-24145198IPR006447Myb domain, plants
PfamPF002495.7E-7146197IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MELFPSQPDL SLQIGLPATA TRHDHHHQAR FFGPPSSNNP AMAPPPPLQL PFPMPHLPMP  60
MPPGMGHGGG LYYPNGGLLR PIRGVPLYGP GHGPGPHVVA NNPAMAPPCY CDPYARRSGG  120
ACGGGGGGGR ILGGFPAPKR AARAPRMRWT STLHSRFVHA VELLGGHDRA TPKAVLELMD  180
VKDLTLAHVK SHLQMYRTVK NTERPAASSD QADGFENGSA GEICDDNLLD LHGVGGRTEA  240
ARHARLAAAN DHDGSISAGA LWNSSSREED WSGFPCDSNN ESMQSFKDHM QSKSLEILSD  300
INSCLSETTS SASEPNLDFT LGRPHHRRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-17146200357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17146200357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17146200357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17146200357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g16340.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570081e-91EU957008.1 Zea mays clone 1580405 KANADI-like transcription factor FEATHERED mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571453.10.0probable transcription factor KAN2
TrEMBLI1I1D50.0I1I1D5_BRADI; Uncharacterized protein
STRINGBRADI3G16340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47213665
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.19e-39G2-like family protein