PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g13630.1.p
Common NameBRADI_3g13630, LOC100845805
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 397aa    MW: 43188.4 Da    PI: 9.8126
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g13630.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.48.9e-47511812128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eel+ +yL++kv+gk++++ + i+ +d+y+++PwdLp  ++ ++kew+f+++rd+ky++g+r+nr+t sgyWkatg d+ v +
  Bradi3g13630.1.p  51 MPGFRFHPTEEELIEFYLRRKVDGKRFNI-DLISFLDLYRYDPWDLPGLASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKATGADRMVRV 142
                       79***************************.99***************877889**************************************99 PP

               NAM  95 k.....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              ++ +glkktLvfy g+apkg +++W+m+eyrl
  Bradi3g13630.1.p 143 VageagVSRSIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 181
                       8555444445***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5448201IPR003441NAC domain
PROSITE profilePS5100554.36350201IPR003441NAC domain
PfamPF023655.0E-2452181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MTRSRAAPAP GTTTTMAAAG AGGSSPEGQQ QHGDLQAGED HQDQPQQETV MPGFRFHPTE  60
EELIEFYLRR KVDGKRFNID LISFLDLYRY DPWDLPGLAS IGDKEWFFYV PRDRKYRNGD  120
RPNRVTPSGY WKATGADRMV RVVAGEAGVS RSIGLKKTLV FYVGKAPKGL RSSWIMNEYR  180
LPHADAQRYQ KEISLCRVYK RPGIEDNFHL TGTTTRSSAG SKAAGTKHHT AGAAHRTTAT  240
ANRQQHAPMF VSGHHPSPSS LKPYNQASAA GVPAMFRSTA SVASLSSTTS TEEDGTSLYH  300
LKGPNSNPAA AAMQPSMQAS LLNMSSSAAA MAAIPIDELS RAIGSYSTQA GANPNNNQQH  360
PTPPSQISPL LNFPSLEKIW DWNPLLESPK VCTSFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-51382015165NO APICAL MERISTEM PROTEIN
1ut4_B7e-51382015165NO APICAL MERISTEM PROTEIN
1ut7_A7e-51382015165NO APICAL MERISTEM PROTEIN
1ut7_B7e-51382015165NO APICAL MERISTEM PROTEIN
3swm_A1e-50382018168NAC domain-containing protein 19
3swm_B1e-50382018168NAC domain-containing protein 19
3swm_C1e-50382018168NAC domain-containing protein 19
3swm_D1e-50382018168NAC domain-containing protein 19
3swp_A1e-50382018168NAC domain-containing protein 19
3swp_B1e-50382018168NAC domain-containing protein 19
3swp_C1e-50382018168NAC domain-containing protein 19
3swp_D1e-50382018168NAC domain-containing protein 19
4dul_A7e-51382015165NAC domain-containing protein 19
4dul_B7e-51382015165NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g13630.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571314.20.0NAC domain-containing protein 35
TrEMBLA0A0Q3HN850.0A0A0Q3HN85_BRADI; Uncharacterized protein
STRINGBRADI3G13630.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.12e-92NAC domain containing protein 35