PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g10730.1.p
Common NameBRADI_3g10730, LOC100841245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 397aa    MW: 43316.3 Da    PI: 7.3445
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g10730.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.89.2e-32230285156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Bradi3g10730.1.p 230 KARRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 285
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.868227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-27228288IPR009057Homeodomain-like
SuperFamilySSF466892.87E-16228287IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-27230285IPR006447Myb domain, plants
PfamPF002491.7E-6232283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MQMAMEEDPA SDTRRRFRDY LLALEEERRK IHVFQRELPL CLDLVTQTIE GMKSQMDAVV  60
GSEETVSDHG PVLEEFIPLK PSLSLCSSEE ESTHAVAPVN SPKKDESERA RPPTPETKKA  120
MPDWLQSVQL WSQEPQQSCP NKELPCKPVA LNATKTRGAF HPFEKEKRAE PELPASSTTA  180
AASSAVVGDS CGDKATSDTE VAHEKIKDTN KDMEKDSKEG QSSQQQHNRK ARRCWAPELH  240
RRFLQALQQL GGSHVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTTRRP SSTVAQSNNA  300
AQAAAPQFVV VGSCIWVPPQ EYAAAAAQQQ ANNNSPAVVY APVATMPSSS SALHVPSKKK  360
QTTSRGSKHS EDQRSGDASS SSGSPAVSSS SQTTSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g10730.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572723.10.0transcription factor NIGT1
SwissprotQ6Z8691e-123NIGT1_ORYSJ; Transcription factor NIGT1
TrEMBLI1HZP00.0I1HZP0_BRADI; Uncharacterized protein
STRINGBRADI3G10730.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Representative plantOGRP54151221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-68G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sawaki N, et al.
    A nitrate-inducible GARP family gene encodes an auto-repressible transcriptional repressor in rice.
    Plant Cell Physiol., 2013. 54(4): p. 506-17
    [PMID:23324170]