PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g09160.1.p
Common NameBRADI_3g09160, LOC104583488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 493aa    MW: 54046.1 Da    PI: 6.7168
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g09160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.93.5e-31107160255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH +F++ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Bradi3g09160.1.p 107 PRLRWTPDLHMAFIHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 160
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.766103163IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-28103161IPR009057Homeodomain-like
SuperFamilySSF466898.6E-14106161IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-22107162IPR006447Myb domain, plants
PfamPF002496.4E-9108159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MITREEEEIM RDVKEKQVLV EILEDEDDGK KRSMDGIRPL DLNEGVDVES EEGEVGDEDD  60
DGDDGGSTTD VAGSGSSSND VSGSQKGAGS GEQRVPSVRQ YNRSKLPRLR WTPDLHMAFI  120
HAVERLGGQE RATPKLVLQM MNVRGLSIAH VKSHLQMYRS KKLDHDGRQI RGSAISSVFS  180
PMDFHSMRGD RRFHDMYLQR SAGLSSRPEQ YGSFFAASRS GETSSRLYGI LQGRSPPMQT  240
FGFKNCGFRN QEWSFNQHDM IGRRDGKASS SSSATPHLFA SSPLRRWPLA PGAGAAGEHR  300
PERSIGYFAA GNNGSLAPIS RVVAPATSAV PGQGEGNRRL PFRWHGGDGS NDAKNRLSDP  360
VVIDEALESR LERQKHLEPR APTTTPADEA RHKRPPPEME TIDGTPDLKL SLSPTTADTY  420
TDRANKRKKI TAPSEQDMDD YCSNKISISL SLSPPAAPMS MQRQEKTIRG GSEEAALGQS  480
TLDLTMSIKA LE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-18108162357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-18108162357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-18108162357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-18108162357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g09160.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736062e-60AK073606.1 Oryza sativa Japonica Group cDNA clone:J033048N17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234086.10.0uncharacterized protein LOC104583488
TrEMBLI1HZ560.0I1HZ56_BRADI; Uncharacterized protein
STRINGBRADI3G09160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-34G2-like family protein