PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g05720.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 485aa    MW: 52083.9 Da    PI: 7.1167
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g05720.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.64.8e-40220295176
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                       +Cq+egC+adls ak+yhrrhkvCe h+ka++v+++g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk+
  Bradi3g05720.1.p 220 RCQAEGCKADLSAAKHYHRRHKVCEYHAKAAAVAANGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKP 295
                       6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-35215282IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188218295IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-37219295IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30221294IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MMSSRQQLSP GTGTMPPISG DADFGSCYTS THHPYAAFDG SPSAAVDHRP PLLHHHHQQL  60
YDTTGLDYAA LFPFAPQQDN NPPAHLFPNQ LPPFTANSTT MLLQPPMLTP LPGLPTSSPP  120
PAPGDAYQLH HPFGGFQLKR ENEGGLFPFS DAMAASGVSG VGGGSGGRIG LNLGRRTYFS  180
PADVLAVDRL LMRTRGGLGG GGMGVLGLGL GGGIMQQPPR CQAEGCKADL SAAKHYHRRH  240
KVCEYHAKAA AVAANGKQQR FCQQCSRFHV LAEFDEAKRS CRKRLTEHNR RRRKPVGVQG  300
KDSPPPPPSK KLEAGITTSS YAGDHTTTNK SSSTAAAAVL SPSASAFSCL QQQEEELDDN  360
NEGSGGRPTT LSLAAPPQRD YGGALDTMLL MHHHHHQAAA AVVQDDDQEQ DFMMTSLVQS  420
HHHHQQQQQQ GEVSGNILSC SPTASDQRRQ NHQQMQINDG GDDSGCCNNS GMQQQQHFFE  480
VDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-282212941184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277294KRSCRKRLTEHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g05720.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571005.20.0squamosa promoter-binding-like protein 10
TrEMBLA0A2K2CVE40.0A0A2K2CVE4_BRADI; Uncharacterized protein
STRINGBRADI3G05720.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-41squamosa promoter binding protein-like 8