PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g05510.1.p
Common NameBRADI_3g05510, LOC100823377
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 330aa    MW: 35413.6 Da    PI: 9.4569
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g05510.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1261.5e-3960137178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC ++l  ak+yhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  Bradi3g05510.1.p  60 RCQVEGCGVELRAAKDYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDEKKRSCRRRLSDHNARRRKQQP 137
                       6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-3353122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.85558135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-3859140IPR004333Transcription factor, SBP-box
PfamPF031103.6E-3061134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEWTAPKPAT SPPTHLLWDW GDSAAPGSSG DAAGRRGKEK RAKGEEGGGG GGGGGGAVVR  60
CQVEGCGVEL RAAKDYHRKH RVCEAHTKCP RVVVAGQERR FCQQCSRFHA LSEFDEKKRS  120
CRRRLSDHNA RRRKQQPDAF SFAPARLPST LIFDDRRQIS FVWNKGPPSH VRPFACSPWE  180
SPSEFKLSQV KNTRGVSTNG QVHLDKSHLS NAVPTLSHDM DELFPVKGPD ASLAASKLDG  240
APDLQHALSL LSASSRGLPD PAQQASCLVQ FSGASQNSRG LHSSHGVSSA SAPCAEGQPM  300
APSPHLVRFT VDGTSSGYDT TFFGLNKIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2651134184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g05510.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570368.10.0squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-90SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLI1HXS70.0I1HXS7_BRADI; Uncharacterized protein
STRINGBRADI3G05510.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.43e-43squamosa promoter binding protein-like 10