PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g04450.1.p
Common NameBRADI_3g04450, LOC100825843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Whirly
Protein Properties Length: 232aa    MW: 25380.8 Da    PI: 10.0817
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g04450.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly187.81.8e-58541912139
            Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94 
                       v+k+kaal++ +++p+f++++sg  ++k++G+++l++ +a+++r+yd++kkq fals+tev++l++l+s esceffhdp++k+s+eG+v+k+l
  Bradi3g04450.1.p  54 VFKGKAALSISPILPNFTKIESGGSRVKKNGSVMLTFFPAVGQRQYDYSKKQLFALSPTEVGSLISLGSAESCEFFHDPSMKSSHEGQVKKSL 146
                       9******************************************************************************************** PP

            Whirly  95 kvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                       ++ Pl +  G+fvn++v n+++k+ne++svPv+kaefav+r++l+
  Bradi3g04450.1.p 147 SITPLGNDNGYFVNITVLNNVQKTNERLSVPVTKAEFAVMRTALS 191
                       ******************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.104.1E-7441209IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.77E-7246231IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.0E-5954188IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MLRLSRFLPS TSRKVSDLKD VLWSGSVTFE HALSTSAANV DENASARKFA SYTVFKGKAA  60
LSISPILPNF TKIESGGSRV KKNGSVMLTF FPAVGQRQYD YSKKQLFALS PTEVGSLISL  120
GSAESCEFFH DPSMKSSHEG QVKKSLSITP LGNDNGYFVN ITVLNNVQKT NERLSVPVTK  180
AEFAVMRTAL SYALPHIMGW DQALTSHPQS PTAPASKPRV ERPHPDSEWE R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A5e-75452078169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_B5e-75452078169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_C5e-75452078169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_D5e-75452078169Single-stranded DNA-binding protein WHY2, mitochondrial
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g04450.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2499760.0AK249976.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf60h16, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574931.11e-171single-stranded DNA-binding protein WHY2, mitochondrial
SwissprotQ8VYF74e-75WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLI1HXE91e-170I1HXE9_BRADI; Uncharacterized protein
STRINGBRADI3G04450.11e-171(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-77WHIRLY 2