PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g03970.1.p
Common NameBRADI_3g03970, LOC100828399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 215aa    MW: 23317.3 Da    PI: 10.8103
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g03970.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.2e-1888143156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rrk+ ++t+eq   Lee F+ ++ +s+ e+++LA++l+L  rqV vWFqNrRa+ k
  Bradi3g03970.1.p  88 RRKKLRLTEEQAALLEESFRAHNVLSHGEKQDLARRLRLRARQVEVWFQNRRARTK 143
                       79999*************************************************98 PP

2HD-ZIP_I/II108.54.8e-3589177189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rl++eq++lLEesF++++ L++ +K++lar+L+l++rqv+vWFqnrRARtk+kq+E d++ L+r +d+l+++n+ L+++ ++Lr+
  Bradi3g03970.1.p  89 RKKLRLTEEQAALLEESFRAHNVLSHGEKQDLARRLRLRARQVEVWFQNRRARTKLKQTELDCDLLRRLCDRLTHDNALLRRQLADLRS 177
                       69***********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1758146IPR009057Homeodomain-like
PROSITE profilePS5007117.49185145IPR001356Homeobox domain
SMARTSM003896.9E-1487149IPR001356Homeobox domain
SuperFamilySSF466898.98E-1887153IPR009057Homeodomain-like
CDDcd000864.40E-788146No hitNo description
PfamPF000461.9E-1588143IPR001356Homeobox domain
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
SMARTSM003406.7E-7145188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSSVSTISSS GMAMAISMED SPEDHQLVDT RLSLFSGAGL SRPPPPQALL LQAAPQPEHQ  60
ASPAGRKKKA GSKQNKRAEE MGSGDGARRK KLRLTEEQAA LLEESFRAHN VLSHGEKQDL  120
ARRLRLRARQ VEVWFQNRRA RTKLKQTELD CDLLRRLCDR LTHDNALLRR QLADLRSAGS  180
GSSSGSSSSS SRLTWNSSDA CPSCSKIAGA GLSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g03970.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054123e-36AP005412.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0050G13.
GenBankAP0149583e-36AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126103e-36CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570938.21e-152putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX66e-41HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLI1HX941e-151I1HX94_BRADI; Uncharacterized protein
STRINGBRADI3G03970.11e-151(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-20homeobox from Arabidopsis thaliana