PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g03538.2.p
Common NameBRADI_3g03538, LOC100844682
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 470aa    MW: 52005.3 Da    PI: 6.8281
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g03538.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-33281335155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWt eLHerFvea+++LGG+ekAtPk +l+lmkv+gLt++hvkSHLQkYRl
  Bradi3g03538.2.p 281 KTRMRWTLELHERFVEALKKLGGPEKATPKGVLKLMKVEGLTIYHVKSHLQKYRL 335
                       68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8278338IPR017930Myb domain
SuperFamilySSF466893.05E-17280335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-30280336IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25281336IPR006447Myb domain, plants
PfamPF002493.1E-9283334IPR001005SANT/Myb domain
PfamPF143794.7E-20371415IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MSTQSVIAVK QPPVQHLHSM ESQWNLNDAH TCSAKQPPVH RMFSVISDDC ASTSDARSSC  60
TTQFSTIKTE LIRSSSMTKI LPFELQKCST TDFNPGRSFS HVSQTDLSDP ILSSSSTFCT  120
SLYSSLSTNS KCRETGALPF LPHPRKLEQQ HSSAGQSPNS SLLLAADPSN SGHGDAEHSD  180
DLKDFLNLSG DASGSGFHEG ISNCMDFNEQ MEFQFLSEQL GIAITDNEEI PRLDDIYGRP  240
QQPLALPLSS SSDQEDGRDA GSPVKVQLSS SSSSGAAGCN KTRMRWTLEL HERFVEALKK  300
LGGPEKATPK GVLKLMKVEG LTIYHVKSHL QKYRLAKYIP EKKEEKKPSS EDKKAQSTAD  360
GIDPAKKKSL QMAEALRMQI EVQKQLHEQL EVQRELQLRI EEHARYLQLI LEQQKVRKCP  420
SSMKSSMEGE SSGSKPKEKT EMRAETPSAP SPKRKFPDID IEHNQQTDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-25281338259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g03538.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570911.10.0protein PHOSPHATE STARVATION RESPONSE 3 isoform X1
SwissprotQ6YXZ41e-175PHR3_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLA0A0Q3F1280.0A0A0Q3F128_BRADI; Uncharacterized protein
STRINGBRADI3G03538.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.25e-71G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]