PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g00550.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 286aa    MW: 31252.4 Da    PI: 10.9923
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g00550.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.3e-29180229251
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Bradi3g00550.4.p 180 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 229
                       9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.7E-13177230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-25178229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-20180229IPR006447Myb domain, plants
PfamPF002491.9E-6181230IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MELFPRQPDL ARPTSSSSSA SFPPAPAPAP TTAWLRPLDT TTTAGNNMDQ FGHLGFWQAP  60
GSAKDGDLRT PSARTAAPPS NHFLSSATAG SYKQQQHVNS ISHGGCYSNN HHYYERMNAL  120
LKPIRGVPIY HHHPFQLQHQ HQQQQQQKHM VMGSRSINNG GGGFLSSSRF PAGRRSLRAP  180
RMRWTTTLHA RFVHAVELLG GHERATPKSV LELMDVKDLT LAHVKSHLQD SLKVLITDQR  240
VRSPTRAYRK PSAPAGSSVQ IKMEPVQILT AAILTMVCGA TLQAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-13181229351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13181229351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13181229351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13181229351Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13181229452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g00550.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1016686e-41FP101668.1 Phyllostachys edulis cDNA clone: bphyst006o10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233652.11e-132probable transcription factor KAN2 isoform X1
RefseqXP_014755462.11e-133probable transcription factor KAN2 isoform X2
TrEMBLA0A2K2CUG20.0A0A2K2CUG2_BRADI; Uncharacterized protein
STRINGBRADI3G00550.11e-115(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-33G2-like family protein