PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g62380.2.p
Common NameBRADI_2g62380, LOC100842955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 347aa    MW: 36363.9 Da    PI: 8.5765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g62380.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.84.2e-3799159262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +e  l+cprCdstntkfCy+nnysl+qPr+fC+aCrryWt+GGalrnvPvGgg r++ k+s
  Bradi2g62380.2.p  99 PEPGLNCPRCDSTNTKFCYFNNYSLTQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRS 159
                       567899*************************************************988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3389155IPR003851Zinc finger, Dof-type
PfamPF027011.6E-31103157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.649103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MIFPPAFLDS SSCWNTNHNN QLQQLANGSD HLTSSSPSAA AAAGGNGNNQ LGHQEGGGLQ  60
VMAPTAAGAG GDEAAINNNS SSKAMSMSER ARLARVPQPE PGLNCPRCDS TNTKFCYFNN  120
YSLTQPRHFC RACRRYWTRG GALRNVPVGG GYRRHAKRSS KPKSSSTSAA AAASSSPAPA  180
TTTTCSTAAA APQSSTLQSM FCNNSSNNNS SNMFDLGLSS SSFPFLQQQE QQQQWAQQMQ  240
QSFPFLQAMD MGMGQPMPLP AATMQGMFHL GLHTGAGDDN AHFGGGHHMA QLPPAPGKRS  300
SEQQQDYAQI SSGRHGGNGS MYGDHQHVVN GGGGYAFYSS SSAAGN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g62380.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843621e-101AM084362.1 Hordeum vulgare subsp. vulgare dof14 gene for dof zinc finger protein 14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753866.10.0dof zinc finger protein DOF3.2
TrEMBLA0A0Q3GMU70.0A0A0Q3GMU7_BRADI; Uncharacterized protein
STRINGBRADI2G62380.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.14e-39OBF-binding protein 3