PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g62067.1.p
Common NameLOC100834697
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 257aa    MW: 26734.7 Da    PI: 8.0761
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g62067.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.53.4e-29114167155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +pr++W+p+LH+rFv++v++L G++ A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Bradi2g62067.1.p 114 RPRMVWNPQLHKRFVDVVAHL-GIKSAVPKTIMQLMNVEGLTRENVASHLQKYRL 167
                       59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.407111170IPR017930Myb domain
SuperFamilySSF466893.94E-18111171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-30111172IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23115167IPR006447Myb domain, plants
PfamPF002492.5E-7116166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGEEAGGGGG GEYARVSEWE TGLPGSDELT PLSQPLVPPG LAAAFRIPPE PGRTLLDVHR  60
ASSATVSRLR SSSSSSSGGG GSFPTFPSGH GGAASDTGAD SAAAASELEK TSKRPRMVWN  120
PQLHKRFVDV VAHLGIKSAV PKTIMQLMNV EGLTRENVAS HLQKYRLYVK RMQGLSNEGP  180
SPSDHIFAST PVPPSLREPQ VPSAAMAPMY HHHPMGGGGG GMTGGYYQPQ QQHGGHAVYN  240
GYGGGGGYSQ YHHGDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A4e-34114170157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g62067.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3575051e-110AK357505.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1055A13.
GenBankKC6682591e-110KC668259.1 Hordeum vulgare haplotype 1 LUX (LUX) gene, complete cds.
GenBankKC6682621e-110KC668262.1 Hordeum vulgare haplotype 4 LUX (LUX) gene, complete cds.
GenBankKC6682661e-110KC668266.1 Hordeum vulgare haplotype 8 LUX (LUX) gene, complete cds.
GenBankKC6682671e-110KC668267.1 Hordeum vulgare haplotype 9 LUX (LUX) gene, complete cds.
GenBankKC6682681e-110KC668268.1 Hordeum vulgare haplotype 10 LUX (LUX) gene, complete cds.
GenBankKC6682691e-110KC668269.1 Hordeum vulgare haplotype 11 LUX (LUX) gene, complete cds.
GenBankKC6682721e-110KC668272.1 Hordeum vulgare haplotype 14 LUX (LUX) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565161.10.0transcription factor PCL1
SwissprotQ94DH38e-85PCL1_ORYSJ; Transcription factor PCL1
TrEMBLI1HVM50.0I1HVM5_BRADI; Uncharacterized protein
STRINGBRADI2G62067.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.31e-49G2-like family protein