PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g59110.2.p
Common NameBRADI_2g59110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 289aa    MW: 30505.5 Da    PI: 8.6772
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g59110.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP45.81.6e-146374778
                      SSEEETTT--SS--S-STTTT-------S--- CS
               SBP 47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78
                      s fh l efDe krsCr+rL++hn+rrrk+q+
  Bradi2g59110.2.p  6 SGFHLLVEFDEVKRSCRKRLDGHNRRRRKQQP 37
                      77***************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114113.272135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.9E-11639IPR004333Transcription factor, SBP-box
PfamPF031103.7E-7734IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MLPSGSGFHL LVEFDEVKRS CRKRLDGHNR RRRKQQPDPL GPAGLFANHH GGGTRFVSYP  60
QIFSTTTSMA PEHKWPGSIA VKTEADAFQV EQYYSSLQLN GAANAAASLF HGKERSKRFP  120
FLSDHHGDTG FQQQPFTITP SSESSSNSSS RHSNGNKMFA TNDGGPDHNC ALSLLSDSPT  180
TQAAHTMITA AAQHLGGARI HYNVGGDGGG GVSLTGLSYA SAIMGDNKGS AQAAMASSTR  240
HAGAVTTAPS VAAQLQQYHG YYQHQVNGDQ GNSADAGASM QALPFSSW*
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g59110.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232756.10.0squamosa promoter-binding-like protein 2
SwissprotQ0JGI13e-65SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLA0A0Q3RDJ90.0A0A0Q3RDJ9_BRADI; Uncharacterized protein
STRINGBRADI2G59110.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-15SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]