PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g59110.1.p
Common NameBRADI_2g59110, LOC100823756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 396aa    MW: 41667.1 Da    PI: 9.0646
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g59110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-4068144278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       C vegC+adls+++eyhrrhkvCe+hsk+pvv v+g++qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+q+
  Bradi2g59110.1.p  68 CSVEGCAADLSRCREYHRRHKVCEAHSKTPVVSVAGQQQRFCQQCSRFHLLVEFDEVKRSCRKRLDGHNRRRRKQQP 144
                       **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-3362129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.82965142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3866146IPR004333Transcription factor, SBP-box
PfamPF031103.5E-2968141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDWEAKMPSW DLGTVVGPSG GGGGGLDLKL GGPTSWRPVP AATAAPVAPS SSPTPAKRAR  60
AGAPAPACSV EGCAADLSRC REYHRRHKVC EAHSKTPVVS VAGQQQRFCQ QCSRFHLLVE  120
FDEVKRSCRK RLDGHNRRRR KQQPDPLGPA GLFANHHGGG TRFVSYPQIF STTTSMAPEH  180
KWPGSIAVKT EADAFQVEQY YSSLQLNGAA NAAASLFHGK ERSKRFPFLS DHHGDTGFQQ  240
QPFTITPSSE SSSNSSSRHS NGNKMFATND GGPDHNCALS LLSDSPTTQA AHTMITAAAQ  300
HLGGARIHYN VGGDGGGGVS LTGLSYASAI MGDNKGSAQA AMASSTRHAG AVTTAPSVAA  360
QLQQYHGYYQ HQVNGDQGNS ADAGASMQAL PFSSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-26681411184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g59110.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3560771e-129AK356077.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1029L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232756.10.0squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-118SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLI1HUP50.0I1HUP5_BRADI; Uncharacterized protein
STRINGBRADI2G59110.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-33SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]