PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g57297.2.p
Common NameBRADI_2g57297, LOC100825714
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 342aa    MW: 36312.5 Da    PI: 9.8168
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g57297.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.11.1e-29108553128
               NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Bradi2g57297.2.p  10 IGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAESSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 85 
                       4789**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.0611106IPR003441NAC domain
SuperFamilySSF1019419.55E-347105IPR003441NAC domain
PfamPF023652.3E-121485IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MYTCAAMAAI GEKEWFFYVP RDRKYRNGDR PNRVTASGYW KATGADRMIR AESSRPIGLK  60
KTLVFYSGKA PKGVRSSWIM NEYRLPTADT HRYHKTEISL CRVYKRTGID DGHSSSRSTP  120
SSRAAAATAR HDNNNNKQAA AGNSSSTSTP TPPPTPSKLH LLQQGSPECT SPPPATIATD  180
HQARGHRTKP CGALSGYLQQ SAAGDQQQQD QGAALLHYQP QQYSGGKNNT NNGAAFASTT  240
TYSLLSLVNA ASMGAGGASA AAIDELNTLV GGAQPAASYH IPGTGSLLHH DHFVVPLPTP  300
TTAPLGTLPM SLAAISDKMI WDWNPIPDAA GTRDYGGAGF K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-33810666165NO APICAL MERISTEM PROTEIN
1ut4_B4e-33810666165NO APICAL MERISTEM PROTEIN
1ut7_A4e-33810666165NO APICAL MERISTEM PROTEIN
1ut7_B4e-33810666165NO APICAL MERISTEM PROTEIN
3swm_A4e-33810669168NAC domain-containing protein 19
3swm_B4e-33810669168NAC domain-containing protein 19
3swm_C4e-33810669168NAC domain-containing protein 19
3swm_D4e-33810669168NAC domain-containing protein 19
3swp_A4e-33810669168NAC domain-containing protein 19
3swp_B4e-33810669168NAC domain-containing protein 19
3swp_C4e-33810669168NAC domain-containing protein 19
3swp_D4e-33810669168NAC domain-containing protein 19
4dul_A4e-33810666165NAC domain-containing protein 19
4dul_B4e-33810666165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g57297.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197621e-139FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024315980.10.0NAC domain-containing protein 35 isoform X2
TrEMBLA0A0Q3JEM70.0A0A0Q3JEM7_BRADI; Uncharacterized protein
STRINGBRADI2G57297.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-62NAC domain containing protein 35