PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g56096.1.p
Common NameBRADI_2g56096, LOC100825393
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 263aa    MW: 27940.2 Da    PI: 5.5566
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g56096.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.21.1e-15180233356
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN  L  e ee +++ 
  Bradi2g56096.1.p 180 AMQRQKRMIKNRESAARSRERKQAYIAELESLVSQLEEENAHLSREQEEQNEKR 233
                       689****************************************98877665543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-10178243IPR004827Basic-leucine zipper domain
PfamPF001707.5E-15180241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.967180244IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-11182231No hitNo description
CDDcd147079.33E-19182229No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-14183236No hitNo description
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MASSRVMASS SSPSHTASDL SRFATAAAGR PGGSGLGSMN VEELLRGIYG DIPTPAPADR  60
PMSPVRPAQE TAARRTADEV WKEITGGGSG EEEEVEVAPA GPAAAAVVPG AVGGASEMTL  120
EDFLARESAA KEDAVRVSGP SAPLEEQVAM GFLNGPDGAR GGGGGRGRKR QQMDPMDRAA  180
MQRQKRMIKN RESAARSRER KQAYIAELES LVSQLEEENA HLSREQEEQN EKRLKELKGK  240
VTPVIIAKTS SQDLRRTNSM EW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3680051e-91AK368005.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2066C11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564700.10.0PREDICTED: G-box-binding factor 4-like isoform X2
TrEMBLI1HTR40.0I1HTR4_BRADI; Uncharacterized protein
STRINGBRADI2G56096.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9845410
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-18bZIP family protein