PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g55980.1.p
Common NameLOC100821289
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 356aa    MW: 37435.3 Da    PI: 4.7797
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g55980.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.3e-383893661
            zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       +cprCds ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Bradi2g55980.1.p 38 PNCPRCDSPNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 93
                      58***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-292083IPR003851Zinc finger, Dof-type
PfamPF027011.6E-313892IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7893892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDMLSSHPHE AMLPYVPRPP PSLLVDRRAY KTGAEVAPNC PRCDSPNTKF CYYNNYSLTQ  60
PRYFCKGCRR YWTKGGSLRN VPVGGGCRKN RRGKSSSSSS MRSSSASDSS FSGAGRDAGP  120
FGSHRFGSAT GSLRPDMVLE GMVGNNPADP GHDMRTAADA STIDLAMLYS KFLNNQQPGN  180
NNAVTPESAG GHVMDDGFDT FSGSSDVLRP GVLAAPGGHF DLSPQDGFGE WSGPLSSAGA  240
AGNPASATST TTSAMLCTDA SVQAALGELN FVMDQSCFDA LGLPMPAEDG GASSVGNDLS  300
SWCSIVPSLS TWEEPKYDSL DSFPDDALSL HDHGILAADH DWSADCQGLE ALYMP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g55980.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703064e-95HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564686.20.0uncharacterized protein LOC100821289
TrEMBLI1HTQ30.0I1HTQ3_BRADI; Uncharacterized protein
STRINGBRADI2G55980.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.12e-28Dof family protein