PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g54791.1.p
Common NameBRADI_2g54791, LOC100824981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 234aa    MW: 24884 Da    PI: 7.2154
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g54791.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.34.1e-29127180155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r++Wt+eLH+rFveav++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  Bradi2g54791.1.p 127 KARMVWTTELHRRFVEAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 180
                       68*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.754124183IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-29125185IPR009057Homeodomain-like
SuperFamilySSF466895.64E-20125184IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-25127180IPR006447Myb domain, plants
PfamPF002492.1E-9129179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MLSPRVVRPQ PHAGAASGGS SSSRRHMVDA EAAAAAGACG RVPEWELGLP SAAELTPVSQ  60
PLIPPALAAA FGIDLAGLPP TSVDARLLQD SPTSHLYSRF DEFDEEDEEG EGETEGAATG  120
GGRRGKKARM VWTTELHRRF VEAVAHLGEK GAVPKAIVRL MNVDGLTREN VASHLQKYRL  180
YLKRLHTGGA AAATPPPQVP PPYYSRFDAK PPQDAANRNG LRTFISYDKL GCD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-25127183157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is a critical component of the regulatory circuit of the circadian clock. Binds to specific sites on CCA1 promoter leading to CCA1 activation. Is required for the rhythmic expression of other clock genes such as LHY, GI and APRR1/TOC1. {ECO:0000269|PubMed:21447790}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g54791.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-109HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567265.21e-170transcription factor PCL1
SwissprotQ9LTH42e-36PCLL_ARATH; Transcription factor BOA
TrEMBLA0A0Q3GJF81e-168A0A0Q3GJF8_BRADI; Uncharacterized protein
STRINGBRADI2G54787.11e-167(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.16e-34G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]