PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g52227.1.p
Common NameBRADI_2g52227, LOC100826211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 766aa    MW: 84150.7 Da    PI: 4.7126
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g52227.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.31.4e-1103887592373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        + L++cA+av++gd + a++lL+++++++ p+gd++qRla++f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  ++ + k+s
  Bradi2g52227.1.p 388 HTMLIHCAQAVAAGDRRSATELLKQIRQHSGPRGDATQRLAHCFAEGLEARLAGTGSQVYQSLVAKRTS---VVEFLKAYKLFMAACCFKKVS 477
                       578***************************************************************999...********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +  aN +Il+av g++r+Hi+Df++++GlQWp L++ La+R++gpp++RiTg++ p++g   + ++eetg+rL++ A+e+gvpf+f+  +a +
  Bradi2g52227.1.p 478 FGFANLTILDAVVGKSRLHIVDFGVQYGLQWPGLMRLLAERDGGPPEVRITGIDLPQPGfrPACQIEETGRRLSNCAREFGVPFKFHS-IAAK 569
                       **********************************************************99999*************************.799* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       +e+++ e+L ++++E+l+V ++  l +l+des+ ++   +rd vL+ +++++P+v++ +  +  ++++ F++rf eal +ysa fd+l+a++p
  Bradi2g52227.1.p 570 WETVRAEDLGIDRNEVLVVLCQCGLSNLMDESLVTDGlsPRDLVLRNIRNMRPDVFIQCVANGTYGAPFFVTRFREALFFYSAHFDMLDATIP 662
                       ********************************99998789***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+++er  +Er ++gr++ nv+acega+r+ r et+++W+ r ++aG++++pl+ +++k ak  +++++ + + ++ ++++l+ gWk+r L++
  Bradi2g52227.1.p 663 RDNDERLLIERDIIGRAALNVIACEGADRVDRPETYKQWQVRNHRAGLRQLPLNPEIVKLAKEKVKNHYHKDFIIDVDHQWLLRGWKGRVLYA 755
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                       vSaW
  Bradi2g52227.1.p 756 VSAW 759
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.809361740IPR005202Transcription factor GRAS
PfamPF035145.0E-108388759IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MDATPEEFLR TGGYLVDPEP LSPSLFLDLP PTPRADGPPA AAASAAADLD LDFISRMLME  60
EDIDDKFFYQ YPDQPALLAA QRPYAQIISD TTSSGSPTGT TATSSDDSVI NSNTATSSSD  120
DTTNYTWPYD PIELSQLLRS PPYDGDMGFG GLVTDSPADE DTRSSFFPGD GAPTAEFQQS  180
AALFKGAAEG GTTSFGQNGG SPGTQNSAIL NDPAVEEEAK PAVFYDGDGD QGALVSAFFS  240
GQTGSDMEML NMAFLKGMEE ANKFLPTNNT LPEVISDKPA LRGFTVKKEE LVDGTLTSGN  300
GRGRRYRHDV DDLEAETGRN SKLMMPEHEE TGAREMFDEI MLEGYEMCMK GMEDLRVAMD  360
SEAKKNNTKG TGKAARAKRG TSEVVDLHTM LIHCAQAVAA GDRRSATELL KQIRQHSGPR  420
GDATQRLAHC FAEGLEARLA GTGSQVYQSL VAKRTSVVEF LKAYKLFMAA CCFKKVSFGF  480
ANLTILDAVV GKSRLHIVDF GVQYGLQWPG LMRLLAERDG GPPEVRITGI DLPQPGFRPA  540
CQIEETGRRL SNCAREFGVP FKFHSIAAKW ETVRAEDLGI DRNEVLVVLC QCGLSNLMDE  600
SLVTDGLSPR DLVLRNIRNM RPDVFIQCVA NGTYGAPFFV TRFREALFFY SAHFDMLDAT  660
IPRDNDERLL IERDIIGRAA LNVIACEGAD RVDRPETYKQ WQVRNHRAGL RQLPLNPEIV  720
KLAKEKVKNH YHKDFIIDVD HQWLLRGWKG RVLYAVSAWI AEDDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-413917598374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1HSE90.0I1HSE9_BRADI; Uncharacterized protein
STRINGBRADI2G52227.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-153GRAS family protein