PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g50370.1.p
Common NameBRADI_2g50370, LOC100828887
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 193aa    MW: 20700.2 Da    PI: 10.2722
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g50370.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.7e-3883138459
            zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                       + l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grrkn+
  Bradi2g50370.1.p  83 APLPCPRCRSRDTKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRKNR 138
                       5689**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.75185139IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3185138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2094138IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MAPLVGAFKL FGKVITPPVP AVAGEEEPQR LPGDGERDRT AAIKREAPAG DLEGEETKQQ  60
GQGGGAARRT QLQESAEARA AAAPLPCPRC RSRDTKFCYF NNYNVNQPRH FCKACHRYWT  120
AGGALRNVPV GAGRRKNRPL GPNVGANHHH HHRAPPAAGF NLAFPNAAAS SPNSPSPVYT  180
DGHWQAGPDR RF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g50370.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ9692631e-112AJ969263.1 Hordeum vulgare dof17 gene for dof zinc finger protein 17, cultivated variety Bomi.
GenBankAK3606171e-112AK360617.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1121P17.
GenBankAK3650551e-112AK365055.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030J14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567133.11e-139dof zinc finger protein 5
SwissprotQ5JLR71e-49DOF5_ORYSJ; Dof zinc finger protein 5
TrEMBLI1HRS01e-138I1HRS0_BRADI; Uncharacterized protein
STRINGBRADI2G50370.11e-138(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.15e-28Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]