PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g45117.1.p
Common NameBRADI_2g45117, LOC100837983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 505aa    MW: 53077.9 Da    PI: 5.0553
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g45117.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.26.3e-131884611374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                       lv+lL++cA av++gd+e+a alLa  +    a ++ + + R+a +ft AL++rl+ s +  +   pp ++      e+++ ++ f+e++P+l
  Bradi2g45117.1.p  88 LVHLLMSCAGAVEAGDHEAAAALLADANASlaAVSTSSGIGRVAVHFTDALSRRLFLSPPAGATPTPPAAA----DPEHAFLYHHFYEACPYL 176
                       68************************9998756666699*****************955544444444444....579999999********* PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.skeeleetgerLakfAeelgvpfefnvlva 183
                       kf+h+taNqaIlea++g++ vH++Df+++qGlQWpaL+qaLa Rp+gpp lRiTg+g+p++   ++el+ +g rLa++A++++v+f+f+ ++a
  Bradi2g45117.1.p 177 KFAHFTANQAILEAFHGCDSVHVVDFSLMQGLQWPALIQALALRPGGPPFLRITGIGPPSPPgGRDELRDVGLRLAELARSVRVRFSFRGVAA 269
                       **********************************************************99988****************************** PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                       ++l+++++++L++ pgEa+aVn+vlqlhrll+++++l+   ++d+vL++v sl+Pk+++vveqeadhn++ Fl+rf+eal yysa+fdsl+a+
  Bradi2g45117.1.p 270 NTLDEVHPWMLQIAPGEAVAVNSVLQLHRLLASPADLQAqaPIDAVLDCVASLRPKIFTVVEQEADHNKPGFLDRFTEALFYYSAVFDSLDAT 362
                       **********************************999887799***********************************************999 PP

              GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        + +s+++++ E+ +l+rei+++v++ega+r+erhe l++Wr+rl++aG+++vpl+  a  qa++l+  ++++g++vee +g+l+lgW++r+L
  Bradi2g45117.1.p 363 SAGASSNAAMAEA-YLQREICDIVCHEGAARTERHEPLSRWRDRLGRAGLRAVPLGPGALRQARMLVGLFSGEGHSVEEAEGCLTLGWHGRTL 454
                       6666666666655.5****************************************************************************** PP

              GRAS 368 vsvSaWr 374
                       +s+SaWr
  Bradi2g45117.1.p 455 FSASAWR 461
                       ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.68762441IPR005202Transcription factor GRAS
PfamPF035142.2E-12888461IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MAMGSFPFQW SMDPAPLSSG VDGSLLPSFL PPPPAAAVPD DGTAYYAASD MHSVPCLPEL  60
AAPFQSRDSA AAELAMRRAE EEVAGIRLVH LLMSCAGAVE AGDHEAAAAL LADANASLAA  120
VSTSSGIGRV AVHFTDALSR RLFLSPPAGA TPTPPAAADP EHAFLYHHFY EACPYLKFAH  180
FTANQAILEA FHGCDSVHVV DFSLMQGLQW PALIQALALR PGGPPFLRIT GIGPPSPPGG  240
RDELRDVGLR LAELARSVRV RFSFRGVAAN TLDEVHPWML QIAPGEAVAV NSVLQLHRLL  300
ASPADLQAQA PIDAVLDCVA SLRPKIFTVV EQEADHNKPG FLDRFTEALF YYSAVFDSLD  360
ATSAGASSNA AMAEAYLQRE ICDIVCHEGA ARTERHEPLS RWRDRLGRAG LRAVPLGPGA  420
LRQARMLVGL FSGEGHSVEE AEGCLTLGWH GRTLFSASAW RAAGDGGGGE ENIDSNNSNI  480
GGGSSGSDSN NSSCGVVGAA NMFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-58884614375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566939.10.0PREDICTED: DELLA protein SLR1-like
SwissprotQ2TN881e-130SLR1_ORYSI; DELLA protein SLR1
SwissprotQ7G7J61e-130SLR1_ORYSJ; DELLA protein SLR1
TrEMBLI1HPW50.0I1HPW5_BRADI; Uncharacterized protein
STRINGBRADI2G45117.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-101GRAS family protein