PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g45000.1.p
Common NameBRADI_2g45000, LOC100826860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 222aa    MW: 24676 Da    PI: 9.4503
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g45000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.1e-1979132356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+ +++keq + Lee F+ n+++s +++e LA kl+L  rqV vWFqNrRa+ k
  Bradi2g45000.1.p  79 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRARTK 132
                       67789***********************************************98 PP

2HD-ZIP_I/II119.61.6e-3879166289
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+k++E+++e+Lkr++ +l+een+rL++eveeLr+
  Bradi2g45000.1.p  79 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKHTEMECEYLKRCFGSLTEENRRLQREVEELRA 166
                       9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-1855135IPR009057Homeodomain-like
SuperFamilySSF466897.1E-1968134IPR009057Homeodomain-like
PROSITE profilePS5007116.8674134IPR001356Homeobox domain
SMARTSM003896.6E-1676138IPR001356Homeobox domain
CDDcd000861.08E-1477135No hitNo description
PfamPF000464.3E-1679132IPR001356Homeobox domain
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
SMARTSM003405.5E-21134177IPR003106Leucine zipper, homeobox-associated
PfamPF021835.1E-9134167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGATSPSGLE LTMAVPGLSS SSGSEGFVGC NNSNNGNGNM RDLDMNQPAS GGEEEEFLMG  60
SVEEDEEEVR GAGGPHRPKK LRLSKEQSRL LEESFRLNHT LSPKQKEALA IKLKLRPRQV  120
EVWFQNRRAR TKLKHTEMEC EYLKRCFGSL TEENRRLQRE VEELRAMRMA PPTVLSPHTR  180
QPLPASALTM CPRCERITAA TGPRTARLPS SFNPRRPSAA F*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g45000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457270.0AF145727.1 Oryza sativa homeodomain leucine zipper protein (Oshox3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232077.11e-160homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-127HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-127HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLI1HPV21e-159I1HPV2_BRADI; Uncharacterized protein
STRINGBRADI2G45000.11e-160(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.15e-65homeobox-leucine zipper protein 17