PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g42233.1.p
Common NameBRADI_2g42233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 126aa    MW: 14199.7 Da    PI: 10.5422
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g42233.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.63.3e-13951143
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                      kri n+  r  tf +R++ + KKA+EL +L + +++vi++++ 
  Bradi2g42233.1.p  9 KRIPNDAARRATFRNRLKDLVKKASELATLYNGKACVIVYGEG 51
                      79***************************************84 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-11160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.395157IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-17182IPR002100Transcription factor, MADS-box
CDDcd002661.46E-17282No hitNo description
PRINTSPR004048.3E-6323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-121051IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MTRKKVTLKR IPNDAARRAT FRNRLKDLVK KASELATLYN GKACVIVYGE GEMKHEMWPS  60
VAEAVPILHR YKAMPDIGQC KKTEQIYKAR RENHELHTAS LVHKAMLGRL PGLKGLTFEE  120
VTNVG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g42233.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230798.38e-63agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3IRP66e-88A0A0Q3IRP6_BRADI; Uncharacterized protein
STRINGGRMZM5G839969_P015e-41(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-15AGAMOUS-like 80