PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g41585.2.p
Common NameBRADI_2g41585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 315aa    MW: 34218.4 Da    PI: 6.3057
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g41585.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.16e-38881881101
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aC+aCk++rr+Ca++C lapyfpae+p +f+n h+lFG +n+lk+l+++p+e+r+d m+s++yeA+ ra++P  Ga+g +l+lqq++ ++++e
  Bradi2g41585.2.p  88 ACSACKHQRRRCAPGCLLAPYFPAENPGSFRNSHRLFGIKNILKFLTRAPPEKRDDCMRSMLYEADQRASNPALGAYGAVLSLQQEYIRVRNE 180
                       7******************************************************************************************** PP

            DUF260  94 lallkeel 101
                       la+l+++l
  Bradi2g41585.2.p 181 LAVLEKQL 188
                       **999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.33987188IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3588185IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.25.40.101.3E-4151198IPR011990Tetratricopeptide-like helical domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
TIVFFNCYAS RHPPPCLRPP SSLNSAASPT AASRRSPSAR DLPRKRSTEP TQSPYKPHGG  60
EGAGDGSLSS SSYPSPAAEA QQQQQHLACS ACKHQRRRCA PGCLLAPYFP AENPGSFRNS  120
HRLFGIKNIL KFLTRAPPEK RDDCMRSMLY EADQRASNPA LGAYGAVLSL QQEYIRVRNE  180
LAVLEKQLEQ YRNAAEAALD VVVPPDGFLP TLPQQQQQHH AASALDVVVP PAGFLPLPIQ  240
QQPWMMPQAP TLPLTIPEEL PQPPIYGGFL VDVPPAAGAQ KIDNDDDDED ANVGVKSDED  300
GVFSSMQQHD KAAGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-268919112114LOB family transfactor Ramosa2.1
5ly0_B1e-268919112114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g41585.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3GCV70.0A0A0Q3GCV7_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP158291113
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-26LOB domain-containing protein 22