PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g37130.1.p
Common NameBRADI_2g37130, LOC100830925
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 371aa    MW: 39324.7 Da    PI: 8.8554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g37130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.82e-37103162261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +e+ lkcprCds+ntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Bradi2g37130.1.p 103 PEQGLKCPRCDSANTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 162
                       57899*************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3887161IPR003851Zinc finger, Dof-type
PfamPF027017.0E-32105161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.677107161IPR003851Zinc finger, Dof-type
PROSITE patternPS013610109145IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MIFPPASFLD SSSWNDNNQI NNNFQRHPHH QQQQVVVAGS ASATDGSCHE QLLQPSIMQM  60
QQQQQQLAEG GGHGGAQQAQ AAAMAGKPMS MSERARLARV PLPEQGLKCP RCDSANTKFC  120
YFNNYSLSQP RHFCRACRRY WTRGGALRNV PVGGGYRRHA KRAKQPKQQP ATSSSSAPAT  180
APTSAPPAML PTGNHQQLPS GLLPPLLRLA DFDAMSLGST FVSGAGGMGK PPPLTSSGSV  240
DVPAGCYSLG GGGGAMEQWR SVQQIPAGFP FFHAMAAADN HLAPAAPGMF HYLGLDHGGN  300
GNGEVVGEED NQFHHASATT MPSSKREDGF TRGGSNIISM YGNGDHHHQL NAGYTSSYNS  360
NTAARGNHLL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g37130.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0793561e-102AC079356.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0016H04, complete sequence.
GenBankAK1089331e-102AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
GenBankAP0149611e-102AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankGQ1835521e-102GQ183552.1 Oryza sativa Japonica Group Dof-type zinc finger protein 25 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231760.10.0dof zinc finger protein DOF3.6 isoform X1
TrEMBLI1HM900.0I1HM90_BRADI; Uncharacterized protein
STRINGBRADI2G37130.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.16e-40OBF-binding protein 3