PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g36782.1.p
Common NameBRADI_2g36782, LOC104583239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 273aa    MW: 29842.9 Da    PI: 7.678
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g36782.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF23.47.9e-081347438
                      -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
            SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevavi 38
                        + +r+ t+ kR++ ++K  +EL vLCd+++ ++
  Bradi2g36782.1.p 13 VKDLQRKRTLKKRLASLIKMVFELTVLCDVKAFLV 47
                      56789999***********************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.11247IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-4261IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.6E-14381IPR002100Transcription factor, MADS-box
PfamPF003191.9E-61547IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MATRGALKLK WIVKDLQRKR TLKKRLASLI KMVFELTVLC DVKAFLVSHV PGEEQPVVWP  60
SPEEAPALVE KYKELSALGK VKEIDILTIW TKQVEKHKVK VFNGSRANGE RELKAILRRK  120
LNDLFVGRPR SAEDLTPGVR SELGRLMEGI LKDVGKRIEE KRSAAPPAIA DVPEEVVQAP  180
PAAAPLTMVA PPLMLEPPPT AVPVVEPQQP HDLEAPPPMT LDGQPRHGSF LFEMFDAMDV  240
AGDGGGLPTP EELREVFARA GLLAPQPPPS DA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g36782.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233356.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3G8C30.0A0A0Q3G8C3_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5005722
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06500.14e-14AGAMOUS-like 96