PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g34520.2.p
Common NameLOC100835831
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 256aa    MW: 26732.1 Da    PI: 8.7487
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g34520.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.84.3e-39591591101
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++C+++p f   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+a+
  Bradi2g34520.2.p  59 PCAACKLLRRRCAQECPFSPFFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVHALEAD 151
                       7******************************************************************************************** PP

            DUF260  94 lallkeel 101
                       la+l++++
  Bradi2g34520.2.p 152 LAALRAQI 159
                       **999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.84958159IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-3959156IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MLHSDWQEHE LGKKIKRESA AAAEADRMMA ARRSSSSQLP AAAAAGAGPG SAPFNTMTPC  60
AACKLLRRRC AQECPFSPFF SPLEPHKFAS VHKVFGASNV SKMLLEVHES QRGDAANSLV  120
YEANLRLRDP VYGCMGAILT LQQQVHALEA DLAALRAQIQ LHHHKQQQHT QSSLRPPPPA  180
TAGNNVPSNV LPSSHASQLL AAAAAASTAG PARAAQAAAA MGPAASASSS TTVYAAASSS  240
TDYSSITHEN VPYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-375915911111LOB family transfactor Ramosa2.1
5ly0_B1e-375915911111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g34520.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-108FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566503.20.0LOB domain-containing protein 15
SwissprotQ9AT611e-62LBD13_ARATH; LOB domain-containing protein 13
TrEMBLI1HLF50.0I1HLF5_BRADI; Uncharacterized protein
STRINGBRADI2G34520.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.16e-58LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]