PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g25580.1.p
Common NameBRADI_2g25580, LOC100843550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 850aa    MW: 92840.3 Da    PI: 5.8984
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g25580.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.72.2e-35165239276
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                       Cqv+gCead+ e+k yh+rh+vC  +++a++v+++g++qr+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  Bradi2g25580.1.p 165 CQVPGCEADIRELKGYHKRHRVCLRCAHATAVMLDGVQQRYCQQCGKFHVLLDFDEDKRSCRRKLERHNKRRRRK 239
                       ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-27158226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.539162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-33163242IPR004333Transcription factor, SBP-box
PfamPF031102.7E-27165239IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MDASDSGGAS AAPDAGEPDW DWNHILEFAV RGDDSLILPW DDTLGTAEAG PAEGAFLPAP  60
SPALPVEAEP VAPPPPVEAG GSRSGVRKRD PRLVCPNYLA GIVPCACPEL DEMAAAAEAE  120
EVASEMLAGP RKKSRPASRG NGVAAGGGGG GSGVAGRGGA VEMKCQVPGC EADIRELKGY  180
HKRHRVCLRC AHATAVMLDG VQQRYCQQCG KFHVLLDFDE DKRSCRRKLE RHNKRRRRKP  240
DSKGAFEKEV DEQLDLSADG SGGCELREEN TDGTTCEMVE TVLSNKVLDR ETPVGSEDVL  300
SAPTCTQPSL QNEQSKSVVT FAASVEGCLG TEQENANITN SSMHDTKSVY SSSCPTGRIS  360
FKLYDWNPAE FPRRLRNQIF EWLSSMPVEL EGYIRPGCTI LTVFIAMPQH MWDQLSEDAA  420
NLVRDLVNAP SSLLLGKGAF FVHVNNMIFQ VLKDGATLMS TRLEVQAPRI HYVHPTWFEA  480
GKPVELLLCG SSLDHPKFRS LLSFDGEYLK HDCCRLTSHE TIACVKNAAA LDSQHEIFRI  540
NITQTKADTH GPGFVEVENM IGLSNFVPVL FGSKQLCSEL ERIQDALCGS NEKYKSVFGE  600
VPGATSDLCG RLELKQTAMS GFLIEIGWLI RKSSPDELKN LLSSANIKRW TSVLKFLIQN  660
DFINVLEIIV KSSDNIIGSE ILSNLERGRL EHHVTTFLGY VRHARNIVED RAKYDKQTQL  720
ETRWCGDSAS NQPNLGTSVP FAKENTGDGS EYDLHPTNVE CKEEERMLLV SPKAVSHRQC  780
CSPEMNARWL NPTLGAPFPG GAMRTRLVKT VVVAAVLCFA ACVVVFHPDR VGVLAAPVKR  840
FLFSDSPSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-37164245586squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221239KRSCRRKLERHNKRRRRKP
2225237RRKLERHNKRRRR
3232239NKRRRRKP
4233238KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g25580.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566250.10.0squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLI1HJH80.0I1HJH8_BRADI; Uncharacterized protein
STRINGBRADI2G25580.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Representative plantOGRP48281320
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-136squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]