PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g25380.1.p
Common NameBRADI_2g25380, LOC100835635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 327aa    MW: 32597.1 Da    PI: 7.2717
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g25380.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.51.9e-3097150155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Bradi2g25380.1.p  97 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 150
                       59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-2094154IPR009057Homeodomain-like
PROSITE profilePS5129411.05994153IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-3096155IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-2498150IPR006447Myb domain, plants
PfamPF002491.3E-7100149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MREEEETSWF TRWEEQLPAP DELMPLSSSL ITRDLAAAFD IPTTHGGGGG AGADGAGGGA  60
GAGEMNGGGG ASSAAGSSGG GGGGGGNGDE PARTLKRPRL VWTPQLHKRF VDAVAHLGIK  120
NAVPKTIMQL MSVDGLTREN VASHLQKYRL YLKRMQGLGN GGGGGGGGSH SSGSGTDAAT  180
EHLFATGPSP FLPPGRGAPP GADPYSTPFA PMATHPHHHP HHHHPPPPQI GHFHHPAARP  240
LGHYGAAGPV GGGGFDHGFL SRAVASGGAP VGPPGMHRMV GGGGAMGMMA PSSFADELEL  300
GSRGGGGGGG GGGRRELTLF PTSGDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-3397153157Transcription factor LUX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1302313RGGGGGGGGGGR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g25380.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568454.10.0transcription factor MYBC1
SwissprotO222101e-52MYBC1_ARATH; Transcription factor MYBC1
TrEMBLI1HJF60.0I1HJF6_BRADI; Uncharacterized protein
STRINGBRADI2G25380.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.13e-48G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]