PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g25270.3.p
Common NameBRADI_2g25270, LOC100832952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 265aa    MW: 26928 Da    PI: 7.8892
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g25270.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-4340138199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+++
  Bradi2g25270.3.p  40 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLHELSPFQREDAVNSLAYEADMRLRDPVYGCVGVISVLQHQLRQLQQD 132
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l++++ 
  Bradi2g25270.3.p 133 LSRARF 138
                       *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.63439140IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4340136IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MASSSASSLP GSVITVASSA AAAALSGGSA GAGAGATGSP CAACKFLRRK CQPDCVFAPY  60
FPPDNPQKFV HVHRVFGASN VTKLLHELSP FQREDAVNSL AYEADMRLRD PVYGCVGVIS  120
VLQHQLRQLQ QDLSRARFEL AKYQQQAAAA AAAAADFGGS ANNNCTQNFI NISHHHSTTA  180
IGAGVVGVGG GFGHGHDQFA AVQMLARSYE GDSGAIARLS VNGGSGYDFG YSSAMGGVGG  240
PVSGLGPFLK PGTAGGDERH TAAQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-53381439114LOB family transfactor Ramosa2.1
5ly0_B2e-53381439114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g25270.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1349331e-136AC134933.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0579A05, complete sequence.
GenBankAC1376171e-136AC137617.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0084P24, complete sequence.
GenBankAP0149611e-136AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568446.10.0LOB domain-containing protein 6
RefseqXP_010231373.10.0LOB domain-containing protein 6
RefseqXP_024314121.10.0LOB domain-containing protein 6
RefseqXP_024314122.10.0LOB domain-containing protein 6
SwissprotQ32SG31e-103LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLI1HJD80.0I1HJD8_BRADI; Uncharacterized protein
STRINGBRADI2G25270.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.44e-49LBD family protein